KEGG   Escherichia coli K-12 MG1655: b3951Help
Entry
b3951             CDS       T00007                                 

Gene name
pflD
Definition
(RefSeq) putative glycine radical domain-containing pyruvate formate-lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00620  Pyruvate metabolism
eco00640  Propanoate metabolism
eco00650  Butanoate metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    b3951 (pflD)
   00640 Propanoate metabolism
    b3951 (pflD)
   00650 Butanoate metabolism
    b3951 (pflD)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     b3951 (pflD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFL-like Gly_radical
Motif
Other DBs
NCBI-GeneID: 948454
NCBI-ProteinID: NP_418386
Pasteur: pflD
RegulonDB: ECK120001838
ECOCYC: EG11910
ASAP: ABE-0012934
UniProt: P32674
Position
4143995..4146292
Genome map
AA seq 765 aa AA seqDB search
MTNRISRLKTALFANTREISLERALLYTASHRQTEGEPVILRRAKATAYILEHVEISIRD
EELIAGNRTVKPRAGIMSPEMDPYWLLKELDQFPTRPQDRFAISEEDKRIYREELFPYWE
KRSMKDFINGQMTDEVKAATNTQIFSINQTDKGQGHIIIDYPRLLNHGLGELVAQMQQHC
QQQPENHFYQAALLLLEASQKHILRYAELAETMAANCTDAQRREELLTIAEISRHNAQHK
PQTFWQACQLFWYMNIILQYESNASSLSLGRFDQYMLPFYQTSLTQGEDAAFLKELLESL
WVKCNDIVLLRSTSSARYFAGFPTGYTALLGGLTENGRSAVNVLSFLCLDAYQSVQLPQP
NLGVRTNALIDTPFLMKTAETIRFGTGIPQIFNDEVVVPAFLNRGVSLEDARDYSVVGCV
ELSIPGRTYGLHDIAMFNLLKVMEICLHENEGNAALTYEGLLEQIRAKISHYITLMVEGS
NICDIGHRDWAPVPLLSSFISDCLEKGRDITDGGARYNFSGVQGIGIANLSDSLHALKGM
VFEQQRLSFDELLSVLKANFATPEGEKVRARLINRFEKYGNDIDEVDNISAELLRHYCKE
VEKYQNPRGGYFTPGSYTVSAHVPLGSVVGATPDGRFAGEQLADGGLSPMLGQDAQGPTA
VLKSVSKLDNTLLSNGTLLNVKFTPATLEGEAGLRKLADFLRAFTQLKLQHIQFNVVNAD
TLREAQQRPQDYAGLVVRVAGYSAFFVELSKEIQDDIIRRTAHQL
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcgtatctctcgcctcaaaactgcactgtttgccaatacccgtgaaatctcg
ctggagcgggcgctgctttataccgccagccatcggcaaaccgaaggcgaaccggtgata
ttgcgccgggcgaaagcaacagcgtatatccttgaacatgttgaaatttcgattcgtgat
gaagaactgattgccggtaaccgcaccgtaaaaccgcgcgccgggattatgtcgccggaa
atggacccttactggctgctgaaagagctggatcaattcccgacgcgtccgcaggaccgc
tttgctatcagcgaagaagataaacgtatctaccgtgaagagttgttcccgtactgggaa
aaacgttcgatgaaagatttcatcaacgggcagatgacagatgaagtaaaagccgcgacc
aacacgcagattttcagcatcaaccagacggataaaggccaggggcacattattattgat
tacccacgcctgttgaatcacgggctgggtgagctggtggcacagatgcagcaacattgt
cagcaacagccggagaatcacttttatcaggccgcgttgttactgctggaagcctcgcag
aaacacattttgcgttacgccgaactggcggaaacgatggcggcaaactgcacagatgcc
cagcgtcgcgaagagctgctgactattgcagagatctcccgccataacgcgcaacataag
ccgcagacgttctggcaggcgtgccagttattctggtacatgaacatcattctgcaatac
gaatccaacgccagttcgctatcgttggggcgcttcgaccagtatatgttgccgttctat
cagacatcattaacccagggcgaagatgcggcgttcctgaaagaactgctcgaatcttta
tgggtgaaatgcaacgacatcgtgctgttgcgctccaccagtagcgcgcgttatttcgcc
ggtttcccgaccggctataccgcactgctcggcgggttaaccgagaacggacgtagcgcg
gtgaacgtgctttcgttcctttgccttgacgcctatcaaagcgtgcaattaccgcaaccg
aacctcggcgtgcgcactaacgccttgatcgacacgccgttcctgatgaaaaccgccgaa
accattcgcttcggtaccggtattccgcaaatctttaacgatgaagtggtggtgccagcg
ttcctcaaccgtggcgtttcgctggaagatgcgcgcgactattccgtagtgggctgtgtg
gaattatctattcccggcagaacctacggcttgcatgacatcgcgatgtttaatctgctg
aaagtgatggaaatctgcctgcatgaaaatgaaggcaatgctgcgctgacttatgaaggt
ttactggagcagatccgcgccaagatcagccactacatcaccctgatggttgagggcagc
aatatttgtgatatcggccatcgcgactgggcacctgtaccgctgctctcatcgtttatc
agcgattgtctggaaaaaggccgcgatattaccgatggcggcgcgcgttataacttctcc
ggcgtacaggggatcggtatcgccaacctgagcgattctctccatgcgttgaaagggatg
gtttttgagcaacagcgtttaagttttgacgaattgctgtcggtattaaaagccaacttc
gcaacgccagaaggcgaaaaagtccgcgctcgcttaattaaccgcttcgagaaatacggt
aacgatatcgacgaggtggataacatcagcgccgaactgttgcgccactactgcaaagaa
gtggaaaaataccagaacccgcgcggcggctacttcacgccgggatcgtataccgtttct
gctcacgtcccgttgggatcggtggttggcgcgacgccagacggtcgttttgccggagaa
cagctggcagacggcggcttgtcacccatgctgggccaggacgcacaagggccaacagcg
gtactgaagtcagtcagtaagctcgataacacgctgctgtctaacggtacgttgctgaac
gtgaaattcactccggcgaccctggaaggtgaagcaggattacgcaaactggccgacttc
ttacgggcgtttacccagcttaagttacaacatattcagtttaacgtggtgaacgccgac
acgttgcgggaagcgcaacagcgcccacaagattatgccgggctggtggtgcgcgttgcc
ggatacagcgccttctttgtcgaactgtcgaaggagatccaggatgacatcatccgccgg
acagcgcatcagctgtaa

DBGET integrated database retrieval system