KEGG   Escherichia coli K-12 MG1655: b3955Help
Entry
b3955             CDS       T00007                                 

Gene name
eptC
Definition
(RefSeq) LPS heptose I phosphoethanolamine transferase
  KO
K19353  
heptose-I-phosphate ethanolaminephosphotransferase [EC:2.7.8.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    b3955 (eptC)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     b3955 (eptC)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Core region
  b3955 (eptC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4148532..4150265)
Genome map
AA seq 577 aa AA seqDB search
MHSTEVQAKPLFSWKALGWALLYFWFFSTLLQAIIYISGYSGTNGIRDSLLFSSLWLIPV
FLFPKRIKIIAAVIGVVLWAASLAALCYYVIYGQEFSQSVLFVMFETNTNEASEYLSQYF
SLKIVLIALAYTAVAVLLWTRLRPVYIPKPWRYVVSFALLYGLILHPIAMNTFIKNKPFE
KTLDNLASRMEPAAPWQFLTGYYQYRQQLNSLTKLLNENNALPPLANFKDESGNEPRTLV
LVIGESTQRGRMSLYGYPRETTPELDALHKTDPNLTVFNNVVTSRPYTIEILQQALTFAN
EKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTMTARNTMLTVFSRQTDKQYYMNQQRTQS
AREYDTNVLKPFQEVLNDPAPKKLIIVHLLGTHIKYKYRYPENQGKFDGNTDHVPPGLNA
EELESYNDYDNANLYNDHVVASLIKDFKAANPNGFLVYFSDHGEEVYDTPPHKTQGRNED
NPTRHMYTIPFLLWTSEKWQATHPRDFSQDVDRKYSLAELIHTWSDLAGLSYDGYDPTRS
VVNPQFKETTRWIGNPYKKNALIDYDTLPYGDQVGNQ
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcattccacagaagtccaggctaaacctctttttagctggaaagccctgggttgggca
ctgctctacttttggtttttctctactctgctacaggccattatttacatcagtggttat
agtggcactaacggcattcgcgactcgctgttattcagttcgctgtggttgatcccggta
ttcctctttccgaagcggattaaaattattgccgcagtaatcggcgtggtgctatgggcg
gcctctctggcggcgctgtgctactacgtcatctacggtcaggagttctcgcagagcgtt
ctgtttgtgatgttcgaaaccaacaccaacgaagccagcgagtatttaagccagtatttc
agcctgaaaattgtgcttatcgcgctggcctatacggcggtggcagttctgctgtggaca
cgcctgcgcccggtctatattccaaagccgtggcgttatgttgtctcttttgccctgctt
tatggcttgattctgcatccgatcgccatgaatacgtttatcaaaaacaagccgtttgag
aaaacgttggataacctggcctcgcgtatggagcctgccgcaccgtggcaattcctgacc
ggctattatcagtatcgtcagcaactaaactcgctaacaaagttactgaatgaaaataat
gccttgccgccactggctaatttcaaagatgaatcgggtaacgaaccgcgcactttagtg
ctggtgattggcgagtcgacccagcgcggacgcatgagtctgtacggttatccgcgtgaa
accacgccggagctggatgcgctgcataaaaccgatccgaatctgaccgtgtttaataac
gtagttacgtctcgtccgtacaccattgaaatcctgcaacaggcgctgacctttgccaat
gaaaagaacccggatctgtatctgacgcagccgtcgctgatgaacatgatgaaacaggcg
ggttataaaaccttctggatcaccaaccagcagacgatgaccgcccgcaataccatgctg
acggtattttcgcgccagaccgacaagcagtactacatgaaccagcaacgtacgcagagt
gcgcgtgaatacgacaccaacgtgctgaagccgttccaggaagtgctgaatgaccctgcg
ccgaagaaactgatcattgttcatctgctgggtacgcatatcaaatacaaataccgctac
ccggaaaatcagggcaagtttgatggcaataccgatcatgttccgccgggattaaacgcg
gaagagctggagtcatataacgattatgacaacgctaacctgtataacgatcatgtggtt
gccagcctgattaaagactttaaagcagcaaacccgaacggtttcctggtttatttctct
gaccacggtgaagaggtttacgacacgccgccgcacaaaactcaggggcgtaatgaggac
aacccgacgcgtcatatgtacaccattccgttcctgctgtggacgtcagaaaaatggcaa
gcgactcatccccgtgatttctcgcaggatgttgatcgtaaatacagcctggcggaactg
atccacacctggtcagatttggcgggcttatcttacgacggttacgatccaacccgttca
gtggtgaatccgcagttcaaagaaactacccgctggattggtaacccgtataagaaaaac
gcactgatcgattacgacacactgccctatggcgatcaggtgggtaatcagtaa

DBGET integrated database retrieval system