KEGG   Escherichia coli K-12 MG1655: b3957Help
Entry
b3957             CDS       T00007                                 

Gene name
argE
Definition
(RefSeq) acetylornithine deacetylase
  KO
K01438  
acetylornithine deacetylase [EC:3.5.1.16]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    b3957 (argE)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     b3957 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4153696..4154847)
Genome map
AA seq 383 aa AA seqDB search
MKNKLPPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPVPGTRN
KFNMLASIGQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFI
LDALRDVDVTKLKKPLYILATADEETSMAGARYFAETTALRPDCAIIGEPTSLQPVRAHK
GHISNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKERYHYEAFTVPYPTLN
LGHIHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAPVSERWPGRLTVDELHP
PIPGYECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTLCPTLVLGPGSINQAHQPDEY
LETRFIKPTRELITQVIHHFCWH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaattaccgccatttatcgagatttaccgcgctctgattgccacaccttca
ataagcgccacggaagaggcactcgatcaaagcaatgcagatttaatcactctgctggcg
gactggtttaaagatttgggcttcaatgtggaagtgcagcctgttccaggaactcgcaac
aaattcaatatgctggcaagtatcggacagggggctggcggcttgttgctggcggggcat
accgatacggtgccatttgatgacggtcgctggacgcgcgatccgtttacactgacggag
catgacggcaagctttacggcttaggcaccgccgacatgaaaggcttttttgcgtttatc
cttgatgcgctacgcgatgtcgacgtcacgaaactgaaaaaaccgctctacattctggcg
actgctgatgaagaaaccagtatggccggagcgcgttattttgccgaaactaccgccctg
cgcccggattgcgccatcattggcgaaccgacgtcactacaaccggtacgcgcacataaa
ggtcatatctctaacgccatccgtattcagggccagtcggggcactccagcgatccagca
cgcggagttaacgctatcgaactaatgcacgacgccatcgggcatattttgcaattgcgc
gataacctgaaagaacgttatcactacgaagcgtttaccgtgccataccctacgctcaac
ctcgggcatattcacggtggcgacgcttctaaccgtatttgcgcttgctgtgagttgcat
atggatattcgtccgctgcctggcatgacactcaatgaacttaatggtttgctcaacgat
gcattggctccggtgagcgaacgctggccgggtcgtctgacggtcgacgagctgcatccg
ccgatccctggctatgaatgcccaccgaatcatcaactggttgaagtggttgagaaattg
ctcggagcaaaaaccgaagtggtgaactactgtaccgaagcgccgtttattcaaacgtta
tgcccgacgctggtgttggggcctggctcaattaatcaggctcatcaacctgatgaatat
ctggaaacacggtttatcaagcccacccgcgaactgataacccaggtaattcaccatttt
tgctggcattaa

DBGET integrated database retrieval system