KEGG   Escherichia coli K-12 MG1655: b3958Help
Entry
b3958             CDS       T00007                                 

Gene name
argC
Definition
(RefSeq) N-acetyl-gamma-glutamylphosphate reductase, NAD(P)-binding
  KO
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    b3958 (argC)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     b3958 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4155001..4156005
Genome map
AA seq 334 aa AA seqDB search
MLNTLIVGASGYAGAELVTYVNRHPHMNITALTVSAQSNDAGKLISDLHPQLKGIVDLPL
QPMSDISEFSPGVDVVFLATAHEVSHDLAPQFLEAGCVVFDLSGAFRVNDATFYEKYYGF
THQYPELLEQAAYGLAEWCGNKLKEANLIAVPGCYPTAAQLALKPLIDADLLDLNQWPVI
NATSGVSGAGRKAAISNSFCEVSLQPYGVFTHRHQPEIATHLGADVIFTPHLGNFPRGIL
ETITCRLKSGVTQAQVAQVLQQAYAHKPLVRLYDKGVPALKNVVGLPFCDIGFAVQGEHL
IIVATEDNLLKGAAAQAVQCANIRFGYAETQSLI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatacgctgattgtgggtgccagcggctacgctggcgcagagctagtgacctat
gtaaatcgccatccgcatatgaacataaccgctttgactgtttcagcgcaaagcaatgat
gcgggaaagttaatctccgatttgcatccgcagctaaaaggcatcgttgatctgccgttg
cagccgatgtcggatatcagcgagtttagcccaggggtggacgtagtgtttctcgccacc
gcccatgaagttagccacgatttagcgccgcagtttcttgaagcgggctgcgtggtgttc
gacctttccggcgcgtttcgtgttaacgacgccaccttctatgaaaaatattacggcttt
acccatcaatacccggaactgttggaacaggcagcctacggtctggcggagtggtgcggt
aataaattaaaagaagcgaatttgattgcggtgccgggctgttatccgacggcggcacag
ctggcgctgaaaccgttgattgatgccgatcttcttgacctcaatcagtggccggtgatc
aacgccaccagcggcgtgagcggtgcagggcgtaaagcggccatttcaaacagcttttgt
gaagttagcctgcaaccgtatggcgtctttactcatcgccatcaaccagagatcgccaca
cacctcggtgctgacgttatcttcaccccacatctgggcaatttcccgcgcggcattctc
gaaaccattacctgccgcctgaaatcgggtgtgacccaggcgcaagtcgcgcaagtgtta
cagcaggcgtatgcccataaaccgctggtgcggctgtatgacaaaggcgttccggcgctg
aaaaatgtcgttgggctgccattttgcgatatcgggtttgccgttcagggcgagcatctg
attattgtggcgaccgaagacaacttactgaaaggcgcggcggcacaagcggtacagtgc
gccaatattcgtttcggctatgcggaaacgcagtctcttatttaa

DBGET integrated database retrieval system