KEGG   Escherichia coli K-12 MG1655: b3961Help
Entry
b3961             CDS       T00007                                 

Gene name
oxyR
Definition
(RefSeq) oxidative and nitrosative stress transcriptional regulator
  KO
K04761  
LysR family transcriptional regulator, hydrogen peroxide-inducible genes activator
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    b3961 (oxyR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4158490..4159407
Genome map
AA seq 305 aa AA seqDB search
MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGVMLLERTSRKVLFTQA
GMLLVDQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKL
EMYLHEAQTHQLLAQLDSGKLDCVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREC
VPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLL
PALAVPPERKRDGVVYLPCIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDGHFDKV
LKQAV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgtgatcttgagtacctggtggcattggctgaacaccgccattttcggcgt
gcggcagattcctgccacgttagccagccgacgcttagcgggcaaattcgtaagctggaa
gatgagctgggcgtgatgttgctggagcggaccagccgtaaagtgttgttcacccaggcg
ggaatgctgctggtggatcaggcgcgtaccgtgctgcgtgaggtgaaagtccttaaagag
atggcaagccagcagggcgagacgatgtccggaccgctgcacattggtttgattcccaca
gttggaccgtacctgctaccgcatattatccctatgctgcaccagacctttccaaagctg
gaaatgtatctgcatgaagcacagacccaccagttactggcgcaactggacagcggcaaa
ctcgattgcgtgatcctcgcgctggtgaaagagagcgaagcattcattgaagtgccgttg
tttgatgagccaatgttgctggctatctatgaagatcacccgtgggcgaaccgcgaatgc
gtaccgatggccgatctggcaggggaaaaactgctgatgctggaagatggtcactgtttg
cgcgatcaggcaatgggtttctgttttgaagccggggcggatgaagatacacacttccgc
gcgaccagcctggaaactctgcgcaacatggtggcggcaggtagcgggatcactttactg
ccagcgctggctgtgccgccggagcgcaaacgcgatggggttgtttatctgccgtgcatt
aagccggaaccacgccgcactattggcctggtttatcgtcctggctcaccgctgcgcagc
cgctatgagcagctggcagaggccatccgcgcaagaatggatggccatttcgataaagtt
ttaaaacaggcggtttaa

DBGET integrated database retrieval system