KEGG   Escherichia coli K-12 MG1655: b3963Help
Entry
b3963             CDS       T00007                                 

Gene name
fabR
Definition
(RefSeq) transcriptional repressor of fabA and fabB
  KO
K22105  
TetR/AcrR family transcriptional regulator, fatty acid biosynthesis regulator
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    b3963 (fabR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4161124..4161771
Genome map
AA seq 215 aa AA seqDB search
MGVRAQQKEKTRRSLVEAAFSQLSAERSFASLSLREVAREAGIAPTSFYRHFRDVDELGL
TMVDESGLMLRQLMRQARQRIAKGGSVIRTSVSTFMEFIGNNPNAFRLLLRERSGTSAAF
RAAVAREIQHFIAELADYLELENHMPRAFTEAQAEAMVTIVFSAGAEALDVGVEQRRQLE
ERLVLQLRMISKGAYYWYRREQEKTAIIPGNVKDE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtaagagcgcaacaaaaagaaaaaacccgccgttcgctggtggaagccgcattt
agccaattaagtgctgaacgcagcttcgccagcctgagtttgcgtgaagtggcgcgtgaa
gcgggcattgctcccacctctttttatcggcatttccgcgacgtagacgaactgggtctg
accatggttgatgagagcggtttaatgctacgccaactcatgcgccaggcgcgtcagcgt
atcgccaaaggcgggagtgtgatccgcacctcggtctccacatttatggagttcatcggt
aataatcctaacgccttccggttattattgcgggaacgctccggcacctccgctgcgttt
cgtgccgccgttgcgcgtgaaattcagcacttcattgcggaacttgcggactatctggaa
ctcgaaaaccatatgccgcgtgcgtttactgaagcgcaagccgaagcaatggtgacaatt
gtcttcagtgcgggtgccgaggcgttggacgtcggcgtcgaacaacgtcggcaattagaa
gagcgactggtactgcaactgcgaatgatttcgaaaggggcttattactggtatcgccgt
gaacaagagaaaaccgcaattattccgggaaatgtgaaggacgagtaa

DBGET integrated database retrieval system