KEGG   Escherichia coli K-12 MG1655: b3967Help
Entry
b3967             CDS       T00007                                 

Gene name
murI
Definition
(RefSeq) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00471  D-Glutamine and D-glutamate metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    b3967 (murI)
Enzymes [BR:eco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     b3967 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:eco01011]
 Precursor biosynthesis
  Racemase
   b3967 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-GeneID: 948467
NCBI-ProteinID: NP_418402
Pasteur: murI
RegulonDB: ECK120001184
ECOCYC: EG11204
ASAP: ABE-0012989
UniProt: P22634
Structure
PDB: 

Jmol
Position
4165428..4166285
Genome map
AA seq 285 aa AA seqDB search
MATKLQDGNTPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNVAFPY
GEKSEAFIVERVVAIVTAVQERYPLALAVVACNTASTVSLPALREKFDFPVVGVVPAIKP
AARLTANGIVGLLATRGTVKRSYTHELIARFANECQIEMLGSAEMVELAEAKLHGEDVSL
DALKRILRPWLRMKEPPDTVVLGCTHFPLLQEELLQVLPEGTRLVDSGAAIARRTAWLLE
HEAPDAKSADANIAFCMAMTPGAEQLLPVLQRYGFETLEKLAVLG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaaactgcaggacgggaatacaccttgtctggcagctacaccttctgaacca
cgtcccaccgtgctggtgtttgactccggcgtcggtgggttgtcggtctatgacgagatc
cggcatctcttaccggatctccattacatttatgctttcgataacgtcgctttcccgtat
ggcgaaaaaagcgaagcgtttattgttgagcgagtggtggcaattgtcaccgcggtgcaa
gaacgttatccccttgcgctggctgtggtcgcttgcaacactgccagtaccgtttcactt
cctgcattacgcgaaaagttcgacttcccggttgttggtgtcgtgccggcgattaaacct
gctgcacgtctgacggcaaatggcattgtcggattactggcaacccgcggaacagttaaa
cgttcttatactcatgagctgatcgcgcgtttcgctaatgaatgccagatagaaatgctg
ggctcggcagagatggttgagttggctgaagcgaagctacatggcgaagatgtttctctg
gatgcactaaaacgtatcctacgcccgtggttaagaatgaaagagccgccagataccgtt
gtattgggttgcacccatttccctctactacaagaagaactgttacaagtgctgccagag
ggaacccggctggtggattctggcgcagcgattgctcgccgaacggcctggttgttagaa
catgaagccccggatgcaaaatctgccgatgcgaatattgccttttgtatggcaatgacg
ccaggagctgaacaattattgcccgttttacagcgttacggcttcgaaacgctcgaaaaa
ctggcagttttaggctga

DBGET integrated database retrieval system