KEGG   Escherichia coli K-12 MG1655: b3974Help
Entry
b3974             CDS       T00007                                 

Gene name
coaA
Definition
(RefSeq) pantothenate kinase (EC:2.7.1.33)
  KO
K00867  
type I pantothenate kinase [EC:2.7.1.33]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b3974 (coaA)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     b3974 (coaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4174076..4175026)
Genome map
AA seq 316 aa AA seqDB search
MSIKEQTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSR
LLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRR
VELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIY
DVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWY
INRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLNLKQNILPTRERASLI
LTKSANHAVEEVRLRK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtataaaagagcaaacgttaatgacgccttacctacagtttgaccgcaaccagtgg
gcagctctgcgtgattccgtacctatgacgttatcggaagatgagatcgcccgtctcaaa
ggtattaatgaagatctctcgttagaagaagttgccgagatctatttacctttgtcacgt
ttgctgaacttctatataagctcgaatctgcgccgtcaggcagttctggaacagtttctt
ggtaccaacgggcaacgcattccttacattatcagtattgctggcagtgtcgcggtgggg
aaaagtacaaccgcccgtgtattgcaggcgctattaagccgttggccggaacatcgtcgt
gttgaactgatcactacagatggcttccttcaccctaatcaggttctgaaagaacgtggt
ctgatgaagaagaaaggcttcccggaatcgtatgatatgcatcgcctggtgaagtttgtt
tccgatctcaaatccggcgtgccaaacgttacagcacctgtttactcacatcttatttat
gatgtgatcccggatggagataaaacggttgttcagcctgatattttaattcttgaaggg
ttaaatgtcttacagagcgggatggattatccacacgatccacatcatgtatttgtttct
gattttgtcgatttttcgatatatgttgatgcaccggaagacttacttcagacatggtat
atcaaccgttttctgaaattccgcgaaggggcttttaccgacccggattcctattttcat
aactacgcgaaattaactaaagaagaagcgattaagactgccatgacattgtggaaagag
atcaactggctgaacttaaagcaaaatattctacctactcgtgagcgcgccagtttaatc
ctgacgaaaagtgctaatcatgcggtagaagaggtcagactacgcaaataa

DBGET integrated database retrieval system