KEGG   Escherichia coli K-12 MG1655: b3981Help
Entry
b3981             CDS       T00007                                 

Gene name
secE
Definition
(RefSeq) preprotein translocase membrane subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02024  Quorum sensing
eco03060  Protein export
eco03070  Bacterial secretion system
Module
eco_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    b3981 (secE)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    b3981 (secE)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b3981 (secE)
Secretion system [BR:eco02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   b3981 (secE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE
Motif
Other DBs
NCBI-GeneID: 948486
NCBI-ProteinID: NP_418408
Pasteur: secE
RegulonDB: ECK120000928
ECOCYC: EG10939
ASAP: ABE-0013023
UniProt: P0AG96
Structure
PDB: 

Jmol
Position
4177358..4177741
Genome map
AA seq 127 aa AA seqDB search
MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL
LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS
FITGLRF
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgaataccgaagctcaaggaagcgggcgcggcctggaagcgatgaagtgggtc
gttgtggtggcattgctcctggtggcgattgtcggcaactatctttatcgcgacattatg
ctgccgctgcgtgcgctggccgtagtaattctgattgctgcagcgggtggtgtcgcgctg
ttaacgacaaaaggtaaagctaccgttgcttttgcccgtgaagcgcgtaccgaagtccgt
aaggtcatttggccgactcgccaggaaacattgcacaccacgctgattgtggctgcggtt
accgcagtaatgtcactgatcctgtggggactggatggtattctggttcgcctggtatcc
tttatcactggcctgaggttctga

DBGET integrated database retrieval system