KEGG   Escherichia coli K-12 MG1655: b3986Help
Entry
b3986             CDS       T00007                                 

Gene name
rplL
Definition
(RefSeq) 50S ribosomal subunit protein L7/L12
  KO
K02935  large subunit ribosomal protein L7/L12
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03010  Ribosome
Module
eco_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    b3986 (rplL)
Ribosome [BR:eco03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    b3986 (rplL)
  Bacteria
    b3986 (rplL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L12 Ribosomal_L12_N DUF2648
Motif
Other DBs
NCBI-GeneID: 948489
NCBI-ProteinID: NP_418413
Pasteur: rplL
RegulonDB: ECK120000864
ECOCYC: EG10873
ASAP: ABE-0013038
UniProt: P0A7K2
Structure
PDB: 

Jmol
Position
4180560..4180925
Genome map
AA seq 121 aa AA seqDB search
MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPVEAAEEKTEFDVILK
AAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEV
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcactaaagatcaaatcattgaagcagttgcagctatgtctgtaatggacgtt
gtagaactgatctctgcaatggaagaaaaattcggtgtttccgctgctgctgctgtagct
gtagctgctggcccggttgaagctgctgaagaaaaaactgaattcgacgtaattctgaaa
gctgctggcgctaacaaagttgctgttatcaaagcagtacgtggcgcaactggcctgggt
ctgaaagaagctaaagacctggtagaatctgcaccggctgctctgaaagaaggcgtgagc
aaagacgacgcagaagcactgaaaaaagctctggaagaagctggcgctgaagttgaagtt
aaataa

DBGET integrated database retrieval system