KEGG   Escherichia coli K-12 MG1655: b3987Help
Entry
b3987             CDS       T00007                                 

Gene name
rpoB
Definition
(RefSeq) RNA polymerase, beta subunit
  KO
K03043  
DNA-directed RNA polymerase subunit beta [EC:2.7.7.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b3987 (rpoB)
   00240 Pyrimidine metabolism
    b3987 (rpoB)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    b3987 (rpoB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     b3987 (rpoB)
Transcription machinery [BR:eco03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     b3987 (rpoB)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      b3987 (rpoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4181245..4185273
Genome map
AA seq 1342 aa AA seqDB search
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atggtttactcctataccgagaaaaaacgtattcgtaaggattttggtaaacgtccacaa
gttctggatgtaccttatctcctttctatccagcttgactcgtttcagaaatttatcgag
caagatcctgaagggcagtatggtctggaagctgctttccgttccgtattcccgattcag
agctacagcggtaattccgagctgcaatacgtcagctaccgccttggcgaaccggtgttt
gacgtccaggaatgtcaaatccgtggcgtgacctattccgcaccgctgcgcgttaaactg
cgtctggtgatctatgagcgcgaagcgccggaaggcaccgtaaaagacattaaagaacaa
gaagtctacatgggcgaaattccgctcatgacagacaacggtacctttgttatcaacggt
actgagcgtgttatcgtttcccagctgcaccgtagtccgggcgtcttctttgactccgac
aaaggtaaaacccactcttcgggtaaagtgctgtataacgcgcgtatcatcccttaccgt
ggttcctggctggacttcgaattcgatccgaaggacaacctgttcgtacgtatcgaccgt
cgccgtaaactgcctgcgaccatcattctgcgcgccctgaactacaccacagagcagatc
ctcgacctgttctttgaaaaagttatctttgaaatccgtgataacaagctgcagatggaa
ctggtgccggaacgcctgcgtggtgaaaccgcatcttttgacatcgaagctaacggtaaa
gtgtacgtagaaaaaggccgccgtatcactgcgcgccacattcgccagctggaaaaagac
gacgtcaaactgatcgaagtcccggttgagtacatcgcaggtaaagtggttgctaaagac
tatattgatgagtctaccggcgagctgatctgcgcagcgaacatggagctgagcctggat
ctgctggctaagctgagccagtctggtcacaagcgtatcgaaacgctgttcaccaacgat
ctggatcacggcccatatatctctgaaaccttacgtgtcgacccaactaacgaccgtctg
agcgcactggtagaaatctaccgcatgatgcgccctggcgagccgccgactcgtgaagca
gctgaaagcctgttcgagaacctgttcttctccgaagaccgttatgacttgtctgcggtt
ggtcgtatgaagttcaaccgttctctgctgcgcgaagaaatcgaaggttccggtatcctg
agcaaagacgacatcattgatgttatgaaaaagctcatcgatatccgtaacggtaaaggc
gaagtcgatgatatcgaccacctcggcaaccgtcgtatccgttccgttggcgaaatggcg
gaaaaccagttccgcgttggcctggtacgtgtagagcgtgcggtgaaagagcgtctgtct
ctgggcgatctggataccctgatgccacaggatatgatcaacgccaagccgatttccgca
gcagtgaaagagttcttcggttccagccagctgtctcagtttatggaccagaacaacccg
ctgtctgagattacgcacaaacgtcgtatctccgcactcggcccaggcggtctgacccgt
gaacgtgcaggcttcgaagttcgagacgtacacccgactcactacggtcgcgtatgtcca
atcgaaacccctgaaggtccgaacatcggtctgatcaactctctgtccgtgtacgcacag
actaacgaatacggcttccttgagactccgtatcgtaaagtgaccgacggtgttgtaact
gacgaaattcactacctgtctgctatcgaagaaggcaactacgttatcgcccaggcgaac
tccaacttggatgaagaaggccacttcgtagaagacctggtaacttgccgtagcaaaggc
gaatccagcttgttcagccgcgaccaggttgactacatggacgtatccacccagcaggtg
gtatccgtcggtgcgtccctgatcccgttcctggaacacgatgacgccaaccgtgcattg
atgggtgcgaacatgcaacgtcaggccgttccgactctgcgcgctgataagccgctggtt
ggtactggtatggaacgtgctgttgccgttgactccggtgtaactgcggtagctaaacgt
ggtggtgtcgttcagtacgtggatgcttcccgtatcgttatcaaagttaacgaagacgag
atgtatccgggtgaagcaggtatcgacatctacaacctgaccaaatacacccgttctaac
cagaacacctgtatcaaccagatgccgtgtgtgtctctgggtgaaccggttgaacgtggc
gacgtgctggcagacggtccgtccaccgacctcggtgaactggcgcttggtcagaacatg
cgcgtagcgttcatgccgtggaatggttacaacttcgaagactccatcctcgtatccgag
cgtgttgttcaggaagaccgtttcaccaccatccacattcaggaactggcgtgtgtgtcc
cgtgacaccaagctgggtccggaagagatcaccgctgacatcccgaacgtgggtgaagct
gcgctctccaaactggatgaatccggtatcgtttacattggtgcggaagtgaccggtggc
gacattctggttggtaaggtaacgccgaaaggtgaaactcagctgaccccagaagaaaaa
ctgctgcgtgcgatcttcggtgagaaagcctctgacgttaaagactcttctctgcgcgta
ccaaacggtgtatccggtacggttatcgacgttcaggtctttactcgcgatggcgtagaa
aaagacaaacgtgcgctggaaatcgaagaaatgcagctcaaacaggcgaagaaagacctg
tctgaagaactgcagatcctcgaagcgggtctgttcagccgtatccgtgctgtgctggta
gccggtggcgttgaagctgagaagctcgacaaactgccgcgcgatcgctggctggagctg
ggcctgacagacgaagagaaacaaaatcagctggaacagctggctgagcagtatgacgaa
ctgaaacacgagttcgagaagaaactcgaagcgaaacgccgcaaaatcacccagggcgac
gatctggcaccgggcgtgctgaagattgttaaggtatatctggcggttaaacgccgtatc
cagcctggtgacaagatggcaggtcgtcacggtaacaagggtgtaatttctaagatcaac
ccgatcgaagatatgccttacgatgaaaacggtacgccggtagacatcgtactgaacccg
ctgggcgtaccgtctcgtatgaacatcggtcagatcctcgaaacccacctgggtatggct
gcgaaaggtatcggcgacaagatcaacgccatgctgaaacagcagcaagaagtcgcgaaa
ctgcgcgaattcatccagcgtgcgtacgatctgggcgctgacgttcgtcagaaagttgac
ctgagtaccttcagcgatgaagaagttatgcgtctggctgaaaacctgcgcaaaggtatg
ccaatcgcaacgccggtgttcgacggtgcgaaagaagcagaaattaaagagctgctgaaa
cttggcgacctgccgacttccggtcagatccgcctgtacgatggtcgcactggtgaacag
ttcgagcgtccggtaaccgttggttacatgtacatgctgaaactgaaccacctggtcgac
gacaagatgcacgcgcgttccaccggttcttacagcctggttactcagcagccgctgggt
ggtaaggcacagttcggtggtcagcgtttcggggagatggaagtgtgggcgctggaagca
tacggcgcagcatacaccctgcaggaaatgctcaccgttaagtctgatgacgtgaacggt
cgtaccaagatgtataaaaacatcgtggacggcaaccatcagatggagccgggcatgcca
gaatccttcaacgtattgttgaaagagattcgttcgctgggtatcaacatcgaactggaa
gacgagtaa

DBGET integrated database retrieval system