KEGG   Escherichia coli K-12 MG1655: b3989Help
Entry
b3989             CDS       T00007                                 

Gene name
yjaZ
Definition
(RefSeq) stationary phase growth adaptation protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4189786..4190325
Genome map
AA seq 179 aa AA seqDB search
MKQEVEKWRPFGHPDGDIRDLSFLDAHQAVYVQHHEGKEPLEYRFWVTYSLHCFTKDYEH
QTNEEKQSLMYHAPKESRPFCQHRYNLARTHLKRTILALPESNVIHAGYGSYAVIEVDLD
GGDKAFYFVAFRAFREKKKLRLHVTSAYPISEKQKGKSVKFFTIAYNLLRNKQLPQPSK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggaagtggaaaagtggcgaccttttggacatccggatggtgatattcgtgat
ttatcatttcttgatgctcatcaggctgtctacgttcagcatcatgagggcaaagagcct
ttagagtatcgcttttgggttacctactctcttcactgcttcacaaaagattatgaacat
cagacgaacgaagaaaaacaatcgttaatgtaccacgcgcctaaagaatctcgtcccttc
tgccagcaccgttataacttagcgcgcacacacttaaaaagaactattttggcgctgcca
gaaagcaacgttattcatgccgggtatggtagctatgccgtgattgaggtggacttagac
ggaggagataaggcattttactttgttgcgttcagggctttcagggaaaagaaaaaactc
cgtttgcatgtaactagcgcttatcccatttctgaaaaacagaaaggtaaatcagtgaaa
tttttcaccattgcctacaacttattgagaaataagcagcttcctcagccctcaaaataa

DBGET integrated database retrieval system