KEGG   Escherichia coli K-12 MG1655: b3996Help
Entry
b3996             CDS       T00007                                 

Gene name
nudC
Definition
(RefSeq) NADH pyrophosphatase
  KO
K03426  
NAD+ diphosphatase [EC:3.6.1.22]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    b3996 (nudC)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     b3996 (nudC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4196903..4197676
Genome map
AA seq 257 aa AA seqDB search
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQQQ
RRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCR
ERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESG
IKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTV
ARRLIEDTVAMCRAEYE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtataattgaaaaattagatcacggctggtgggtcgtcagccatgaacaaaaa
ttatggttgccgaagggagaattgccatatggcgaagcggcaaatttcgatcttgtgggt
cagcgcgcactacaaatcggcgaatggcagggggaacctgtttggttagtacaacagcag
cggcgtcacgatatggggtcggtacgtcaggtcattgatctcgatgttgggctgtttcaa
ctggccggacgaggcgtacaactggcggagttttaccgatcgcataaatactgtggttac
tgcgggcatgaaatgtatccgagcaaaaccgaatgggcgatgctgtgcagccattgccgt
gagcgttactacccgcaaatcgccccctgcattattgttgccatccgtcgcgatgattcg
atcctcctcgcccagcatacccgccatcgtaacggtgtccatacagtacttgccggattc
gtcgaagtgggcgaaaccctcgagcaggcagtcgcgcgggaagtgatggaagagagcgga
attaaagttaaaaacttgcgttacgtgacttctcagccgtggccgtttcctcagtcttta
atgaccgcgtttatggcggaatatgacagcggcgacatcgtgatcgacccgaaagaattg
ctcgaggcgaactggtatcgctatgacgatttgccgttactcccgccgcccggcaccgta
gcgcgccgtctgatagaagatacggtggcgatgtgtcgggcagagtatgagtga

DBGET integrated database retrieval system