KEGG   Escherichia coli K-12 MG1655: b3999Help
Entry
b3999             CDS       T00007                                 

Gene name
yjaG
Definition
(RefSeq) DUF416 domain protein
  KO
K09891  
uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4199504..4200094
Genome map
AA seq 196 aa AA seqDB search
MLQNPIHLRLERLESWQHVTFMACLCERMYPNYAMFCQQTGFGDGQIYRRILDLIWETLT
VKDAKVNFDSQLEKFEEAIPSADDFDLYGVYPAIDACVALSELVHSRLSGETLEHAVEVS
KTSITTVAMLEMTQAGREMSDEELKENPAVEQEWDIQWEIFRLLAECEERDIELIKGLRA
DLREAGESNIGIIFQQ
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaaacccaattcatctgcgtctggagcgcctggaaagctggcagcatgtcact
ttcatggcttgcttatgcgaacgcatgtaccccaattacgccatgttctgccagcaaacc
ggttttggtgatgggcaaatttaccgtcgcattctcgatctcatctgggaaacgctgacc
gttaaagacgcaaaagtaaatttcgacagccaactggagaaatttgaagaagcgattcct
tcagccgacgatttcgatctgtacggcgtttatccggcaatcgatgcctgcgtggcgtta
agtgaactggtccattcgcgtttgagtggtgaaacgctcgaacacgcggtggaagtgagt
aagacctccatcacgaccgttgcgatgctggaaatgactcaggctggtcgcgaaatgagc
gatgaagagcttaaagaaaacccagctgtagagcaagaatgggacattcagtgggaaata
ttccgacttttagctgagtgcgaagaacgcgatatcgagctgataaaaggccttagggca
gacctgcgtgaggcgggtgagagcaatattggtataatttttcagcaataa

DBGET integrated database retrieval system