KEGG   Escherichia coli K-12 MG1655: b4003Help
Entry
b4003             CDS       T00007                                 

Gene name
zraS
Definition
(RefSeq) sensory histidine kinase in two-component regulatory system with ZraR
  KO
K07709  two-component system, NtrC family, sensor histidine kinase HydH [EC:2.7.13.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02020  Two-component system
Module
eco_M00499  HydH-HydG (metal tolerance) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b4003 (zraS)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     b4003 (zraS)
Protein kinases [BR:eco01001]
 Histidine kinases
  NtrC family
   b4003 (zraS)
Two-component system [BR:eco02022]
 NtrC family
  HydH-HydG [MD:M00499]
   b4003 (zraS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HATPase_c_5 sCache_3_2 HATPase_c_3 HATPase_c_2 HPTransfase DUF5469 dCache_1 DUF4051
Motif
Other DBs
NCBI-GeneID: 948506
NCBI-ProteinID: NP_418431
Pasteur: hydH
RegulonDB: ECK120000007
ECOCYC: EG10008
ASAP: ABE-0013088
UniProt: P14377
Position
4201926..4203323
Genome map
AA seq 465 aa AA seqDB search
MRFMQRSKDSLAKWLSAILPVVIVGLVGLFAVTVIRDYGRASEADRQALLEKGNVLIRAL
ESGSRVGMGMRMHHVQQQALLEEMAGQPGVLWFAVTDAQGIIILHSDPDKVGRALYSPDE
MQKLKPEENSRWRLLGKTETTPALEVYRLFQPMSAPWRHGMHNMPRCNGKAVPQVDAQQA
IFIAVDASDLVATQSGEKRNTLIILFALATVLLASVLSFFWYRRYLRSRQLLQDEMKRKE
KLVALGHLAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSE
LLELVKPTHLALQAVDLNTLINHSLQLVSQDANSREIQLRFTANDTLPEIQADPDRLTQV
LLNLYLNAIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLDAIFTPYFTTKAEGT
GLGLAVVHNIVEQHGGTIQVASQEGKGSTFTLWLPVNITRKDPQG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttatgcaacgttctaaagactccttagctaaatggttaagcgcgatcctcccc
gtggtcattgttgggctggtgggattgtttgcggtaactgtgattcgtgattatgggcgg
gcaagcgaggcagaccgccaggcattactggaaaaaggtaatgtgcttatccgcgctctg
gagtcgggaagccgcgtagggatggggatgcgaatgcaccatgtacagcaacaggcgctt
ctggaagagatggcgggacagccgggagtgttgtggttcgcagtcaccgatgcgcagggc
atcattattcttcatagcgaccccgataaggtcgggcgtgcgctctattcgccggatgaa
atgcagaaattaaagccagaggaaaactcccgctggcggctgcttgggaaaacggaaact
acgcctgcacttgaggtctatcgtttgttccagccaatgtcagcgccctggcggcatgga
atgcacaatatgccgcgctgtaacggcaaagctgtgccacaagtagatgcacaacaggct
atttttatcgccgttgatgccagtgatctggttgcaacccagagtggggaaaagcgcaat
accctgattatcctcttcgccctggcgacggtcttgctggcaagcgtattgtcattcttc
tggtatcgccgctatctgcgctcgcgccagcttctacaagatgaaatgaagcgcaaagag
aagctggtggcgctggggcatcttgcggcaggcgttgcccacgaaatccgtaacccactt
tcctcgattaaaggactggcgaaatactttgccgagcgcgcgcctgcagggggagaagcg
catcaactggcgcaggtgatggcgaaagaggccgaccgtttaaaccgcgtggtaagcgag
ttgctggaactggttaagccaacgcatctggctttgcaggcggtggatctcaacacgctg
attaaccactcattacagctggtaagtcaggatgcaaacagccgggagatccagttacgc
tttaccgccaacgacacattaccggaaattcaggccgacccggacaggctgactcaggtc
ctgttgaatctctatctcaatgctattcaggcgattggtcagcatggcgtgattagcgtg
acggccagcgaaagcggcgcgggcgtgaaaatcagcgttaccgacagcggtaagggaatt
gcggcagatcagcttgatgccatcttcactccgtacttcaccactaaagccgaaggcacc
ggattggggctggcggtcgtgcataatattgttgaacaacacggtggtacaattcaggtc
gcaagccaggagggaaaaggctcaacgttcaccctctggcttccggtcaatattacgcgt
aaggacccacaaggatga

DBGET integrated database retrieval system