KEGG   Escherichia coli K-12 MG1655: b4004Help
Entry
b4004             CDS       T00007                                 

Gene name
zraR
Definition
(RefSeq) fused DNA-binding response regulator in two-component regulatory system with ZraS: response regulator/sigma54 interaction protein
  KO
K07713  
two-component system, NtrC family, response regulator HydG
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Module
HydH-HydG (metal tolerance) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b4004 (zraR)
Two-component system [BR:eco02022]
 NtrC family
  HydH-HydG [MD:M00499]
   b4004 (zraR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4203320..4204645
Genome map
AA seq 441 aa AA seqDB search
MTHDNIDILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMA
EMDGIATLKEIKALNPAIPVLIMTAYSSVETAVEALKTGALDYLIKPLDFDNLQATLEKA
LAHTHSIDAETPAVTASQFGMVGKSPAMQHLLSEIALVAPSEATVLIHGDSGTGKELVAR
AIHASSARSEKPLVTLNCAALNESLLESELFGHEKGAFTGADKRREGRFVEADGGTLFLD
EIGDISPMMQVRLLRAIQEREVQRVGSNQIISVDVRLIAATHRDLAAEVNAGRFRQDLYY
RLNVVAIEVPSLRQRREDIPLLAGHFLQRFAERNRKAVKGFTPQAMDLLIHYDWPGNIRE
LENAVERAVVLLTGEYISERELPLAIASTPIPLGQSQDIQPLVEVEKEVILAALEKTGGN
KTEAARQLGITRKTLLAKLSR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacgataatatcgatattctggtggtggatgatgacattagccactgcactatt
ttgcaggctttactgcgcggctggggctataacgtcgcgctggcgaacagcgggcgacag
gcgttggagcaggtgcgggaacaggtttttgatcttgtgctttgcgatgtgcgaatggcg
gagatggacggcatcgccacgctgaaagagatcaaagcgttaaacccggcaattccggtg
ctgattatgactgcgtactccagcgtcgagacggcggtagaggcactgaaaactggggcg
ctggattatctcatcaagccgctggatttcgataacctacaggcgacgctggaaaaagcg
ctcgcgcatacgcacagtattgatgctgaaacacctgcggtgactgccagccagttcggt
atggtcggtaaaagcccggcgatgcaacacctgctcagtgaaatcgccctcgtcgcgcca
tcggaagccacggtactgatccacggcgattccggcaccggtaaagagctggtcgccagg
gcgattcacgccagtagcgcacgtagcgaaaaaccgctggtaacgctcaactgtgcggca
ctcaacgaatccttgctggaatctgaattgttcggtcacgaaaaaggggcgtttactgga
gccgataaacgccgggaagggcgctttgttgaggcggacggcggcacgctgtttctcgat
gaaattggcgatatctcgccgatgatgcaggtgcgtctgctgcgtgcgattcaggagcgc
gaagttcagcgtgtcggtagcaaccagattatctcggttgatgtccggctgattgcggcg
acccatcgcgatcttgccgcagaggtgaatgccgggcgttttcgccaggatctctactat
cgcctgaatgtggtggcgattgaagtaccatcgctgcggcaacggcgggaagatatccct
ctgctggctggccattttctgcagcgctttgccgagcgtaatcgcaaggcggtaaaaggt
tttacgccccaggcgatggatctgttgattcattacgactggccgggaaatattcgtgag
ctggaaaacgcggtggaacgggcagtggtgctgctgaccggggaatatatttccgaacgc
gagctgccgctggcgattgccagtacgccgatcccgctgggacaaagtcaggatattcag
ccgttggtggaagtggaaaaagaggtgattctggcggcgctggagaaaacgggcggcaac
aaaaccgaagccgcccgtcagttagggatcacgcgcaaaacgctattggcaaaactgtcg
cgttag

DBGET integrated database retrieval system