KEGG   Escherichia coli K-12 MG1655: b4005Help
Entry
b4005             CDS       T00007                                 

Gene name
purD
Definition
(RefSeq) phosphoribosylglycinamide synthetase phosphoribosylamine-glycine ligase
  KO
K01945  
phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b4005 (purD)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     b4005 (purD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4204642..4205931)
Genome map
AA seq 429 aa AA seqDB search
MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFA
QNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLEGSKAFTKDFLARHKIPTA
EYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDA
GHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT
DDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIM
LRMKSDLVELCLAACESKLDEKTSEWDERASLGVVMAAGGYPGDYRTGDVIHGLPLEEVA
GGKVFHAGTKLADDEQVVTNGGRVLCVTALGHTVAEAQKRAYALMTDIHWDDCFCRKDIG
WRAIEREQN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattagtgattggtaacggcgggcgcgagcacgcgctggcctggaaagcggcc
cagtcgccgctggttgagactgtttttgttgctccgggtaatgcaggcactgcactggaa
cccgcgctgcaaaacgttgctattggcgtgaccgatatcccggcgctgttggatttcgca
caaaacgaaaagattgatctgaccatcgtcggcccggaagcgccgctggtgaaaggcgtg
gtcgataccttccgcgccgccgggctgaaaatcttcggcccaaccgcaggtgcggcccaa
ctggaaggctcaaaagcgtttaccaaagatttcctggcccgccataagatccctacggcg
gaataccagaacttcaccgaggtagaacctgcgctggcgtatctgcgtgagaaaggcgcg
ccaatcgtcattaaagcggacggtctggctgccgggaaaggcgttatcgtggcgatgacg
ctggaagaagcggaagcggctgttcacgatatgctggcgggcaacgcttttggcgacgcg
ggtcatcgcatcgttatcgaagagttcctcgatggcgaagaagcgagctttatcgtgatg
gtggacggcgagcatgtgctgccgatggctaccagccaggatcacaaacgcgtaggcgat
aaagataccggaccaaacaccggcgggatgggcgcttactcccccgcgccggtagtaacc
gatgacgttcatcagcgcaccatggaacgtattatctggccaaccgtgaaaggcatggcg
gcggaaggcaacacctacaccggttttctctacgcgggcctgatgatcgacaaacagggc
aatccgaaggttattgaatttaactgccgctttggcgatccggaaacccagccgattatg
ctgcgcatgaagtccgatctggttgagctctgcctggcggcctgtgaaagcaaactggac
gagaaaacgtccgagtgggatgaacgcgcttctctcggcgtggtgatggctgcgggtgga
tatccgggtgattaccgcaccggtgacgtgatccacggcctgccgctggaagaagtggca
ggcggcaaagtgttccacgcgggcacaaaactggcggatgacgagcaggtagtgaccaac
ggcgggcgcgtactgtgcgtcaccgcgctgggtcataccgtggcagaagcgcagaaacgc
gcctatgccttaatgaccgatatccactgggacgactgcttctgccggaaagatatcggc
tggcgcgctatcgaacgcgagcagaactaa

DBGET integrated database retrieval system