KEGG   Escherichia coli K-12 MG1655: b4006Help
Entry
b4006             CDS       T00007                                 

Gene name
purH
Definition
(RefSeq) IMP cyclohydrolase and phosphoribosylaminoimidazolecarboxamide formyltransferase
  KO
K00602  
phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b4006 (purH)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    b4006 (purH)
Enzymes [BR:eco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     b4006 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     b4006 (purH)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   b4006 (purH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4205943..4207532)
Genome map
AA seq 529 aa AA seqDB search
MQQRRPVRRALLSVSDKAGIVEFAQALSARGVELLSTGGTARLLAEKGLPVTEVSDYTGF
PEMMDGRVKTLHPKVHGGILGRRGQDDAIMEEHQIQPIDMVVVNLYPFAQTVAREGCSLE
DAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYDAIIKEMDDNEGSLTLATRFDLAIKAF
EHTAAYDSMIANYFGSMVPAYHGESKEAAGRFPRTLNLNFIKKLDMRYGENSHQQAAFYI
EENVKEASVATATQVQGKALSYNNIADTDAALECVKEFAEPACVIVKHANPCGVAIGNSI
LDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAIISRQFVEVIIAPSASEEALKITAAKQ
NVRVLTCGQWGERVPGLDFKRVNGGLLVQDRDLGMVGAEELRVVTKRQPSEQELRDALFC
WKVAKFVKSNAIVYAKNNMTIGIGAGQMSRVYSAKIAGIKAADEGLEVKGSSMASDAFFP
FRDGIDAAAAAGVTCVIQPGGSIRDDEVIAAADEHGIAMLFTDMRHFRH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacgtcgtccagtccgccgcgctctgctcagtgtttctgacaaagccggtatc
gtcgaattcgcccaggcactttccgcacgcggtgtggagctgctgtctacagggggcact
gcccgtctgttagcagaaaaaggtctgccggtaaccgaagtttccgattacaccggtttc
ccggagatgatggatggacgcgtgaagaccctgcatccgaaagtacatggtggcattctg
ggccgtcgcggccaggacgatgccattatggaagaacatcagatccagcctatcgatatg
gtggttgttaacctgtatccgttcgcccagaccgtggcccgtgaaggttgctcgctggaa
gatgcggttgagaacatcgatatcggcggcccaacgatggtgcgctccgccgccaagaac
cataaagatgtcgcaatcgtggtgaagagcagcgactatgacgccattattaaagagatg
gatgacaacgaaggatcgctgacgcttgcaacccgtttcgacctcgccatcaaagccttc
gaacacactgccgcctacgacagcatgattgccaactacttcggcagcatggttccggct
taccacggtgaaagcaaagaagccgccggtcgcttcccacgcacgctgaacctgaacttc
attaagaagctggatatgcgttacggcgagaacagccaccagcaggctgccttctatata
gaagagaatgtgaaagaagcctccgttgctaccgcaacccaggttcagggtaaagccctc
tcttataacaacatcgccgataccgatgcggcgctggagtgcgtgaaagagttcgccgag
ccggcatgtgtgattgtgaagcacgccaacccttgcggcgtggctatcggcaattccatt
cttgatgcttacgatcgcgcgtacaaaaccgacccaacctccgcattcggcggcatcatt
gcctttaaccgcgagctggatgcggaaaccgcacaggccatcatttctcgtcagtttgtc
gaagtgattattgcgccgtccgccagcgaagaagccctgaaaatcaccgccgccaaacag
aacgtacgcgttctgacctgcggtcagtggggcgagcgtgttccgggcctcgatttcaaa
cgcgtgaacggcggtctgctggttcaggatcgtgacctggggatggtcggtgcggaagaa
ctgcgcgtggtgaccaaacgtcagccgagcgaacaggaactgcgtgatgcgctgttctgc
tggaaggtggcgaagtttgtgaaatccaacgctatcgtctatgccaaaaacaatatgact
atcggcattggcgcgggccagatgagccgcgtgtactccgcaaaaatcgccggtattaaa
gcggccgatgaaggcctggaagtgaaaggttcctcgatggcttctgacgcgttcttcccg
ttccgcgacggtattgatgccgccgccgctgcgggcgtgacctgcgtaatccagcctggc
ggttctatccgtgatgacgaagtgattgccgccgccgacgagcacggtattgcgatgctc
ttcaccgacatgcgccacttccgccattaa

DBGET integrated database retrieval system