KEGG   Escherichia coli K-12 MG1655: b4011Help
Entry
b4011             CDS       T00007                                 

Gene name
yjaA
Definition
(RefSeq) stress-induced protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4213234..4213617
Genome map
AA seq 127 aa AA seqDB search
MSVLYIQIRRNQITVRDLESKREVSGDAAFSNQRLLIANFFVAEKVLQDLVLQLHPRSTW
HSFLPAKRMDIVVSALEMNEGGLSQVEERILHEVVAGATLMKYRQFHIHAQSAVLSDSAV
MAMLKQK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttctgtatatccaaattcgtcgtaatcaaattactgttcgcgatcttgaaagc
aaacgtgaagtgtcaggagacgctgccttcagtaaccagcgcctgttaatcgccaatttc
tttgttgcagaaaaagttctgcaagatcttgttctgcaactccacccacgttcaacctgg
cattcttttttgccagcaaaacgtatggatattgttgtgagcgcactggaaatgaatgag
ggcggtttgtcacaggttgaggaacgcattctccatgaagtggtcgctggggcaacgtta
atgaaatatcgccagttccacatccatgcgcaatcagcggtactcagtgatagtgcggtc
atggcaatgcttaagcagaaataa

DBGET integrated database retrieval system