KEGG   Escherichia coli K-12 MG1655: b4016Help
Entry
b4016             CDS       T00007                                 

Gene name
aceK
Definition
(RefSeq) isocitrate dehydrogenase kinase/phosphatase
  KO
K00906  
isocitrate dehydrogenase kinase/phosphatase [EC:2.7.11.5 3.1.3.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.5  [isocitrate dehydrogenase (NADP+)] kinase
     b4016 (aceK)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     b4016 (aceK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4218596..4220332
Genome map
AA seq 578 aa AA seqDB search
MPRGLELLIAQTILQGFDAQYGRFLEVTSGAQQRFEQADWHAVQQAMKNRIHLYDHHVGL
VVEQLRCITNGQSTDAAFLLRVKEHYTRLLPDYPRFEIAESFFNSVYCRLFDHRSLTPER
LFIFSSQPERRFRTIPRPLAKDFHPDHGWESLLMRVISDLPLRLRWQNKSRDIHYIIRHL
TETLGTDNLAESHLQVANELFYRNKAAWLVGKLITPSGTLPFLLPIHQTDDGELFIDTCL
TTTAEASIVFGFARSYFMVYAPLPAALVEWLREILPGKTTAELYMAIGCQKHAKTESYRE
YLVYLQGCNEQFIEAPGIRGMVMLVFTLPGFDRVFKVIKDRFAPQKEMSAAHVRACYQLV
KEHDRVGRMADTQEFENFVLEKRHISPALMELLLQEAAEKITDLGEQIVIRHLYIERRMV
PLNIWLEQVEGQQLRDAIEEYGNAIRQLAAANIFPGDMLFKNFGVTRHGRVVFYDYDEIC
YMTEVNFRDIPPPRYPEDELASEPWYSVSPGDVFPEEFRHWLCADPRIGPLFEEMHADLF
RADYWRALQNRIREGHVEDVYAYRRRQRFSVRYGEMLF
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtggcctggaattattgattgctcaaaccattttgcaaggcttcgatgctcag
tatggtcgattcctcgaagtgacctccggtgcgcagcagcgtttcgaacaggccgactgg
catgctgtccagcaggcgatgaaaaaccgtatccatctttacgatcatcacgttggtctg
gtcgtggagcaactgcgctgcattactaacggccaaagtacggacgcggcatttttacta
cgtgttaaagagcattacacccggctgttgccggattacccgcgcttcgagattgcggag
agcttttttaactccgtgtactgtcggttatttgaccaccgctcgcttactcccgagcgg
ctttttatctttagctctcagccagagcgccgctttcgtaccattccccgcccgctggcg
aaagactttcaccccgatcacggctgggaatctctactgatgcgcgttatcagcgaccta
ccgctgcgcctgcgctggcagaataaaagccgtgacatccattacattattcgccatctg
acggaaacgctggggacagacaacctcgcggaaagtcatttacaggtggcgaacgaactg
ttttaccgcaataaagccgcctggctggtaggcaaactgatcacaccttccggcacattg
ccatttttgctgccgatccaccagacggacgacggcgagttatttattgatacctgcctg
acgacgaccgccgaagcgagcattgtttttggctttgcgcgttcttattttatggtttat
gcgccgctgcccgcagcgctggtcgagtggctacgggaaattctgccaggtaaaaccacc
gctgaattgtatatggctatcggctgccagaagcacgccaaaaccgaaagctaccgcgaa
tatctcgtttatctacagggctgtaatgagcagttcattgaagcgccgggtattcgtgga
atggtgatgttggtgtttacgctgccgggctttgatcgggtattcaaagtcatcaaagac
aggttcgcgccgcagaaagagatgtctgccgctcacgttcgtgcctgctatcaactggtg
aaagagcacgatcgcgtgggccgaatggcggacacccaggagtttgaaaactttgtgctg
gagaagcggcatatttccccggcattaatggaattactgcttcaggaagcagcggaaaaa
atcaccgatctcggcgaacaaattgtgattcgccatctttatattgagcggcggatggtg
ccgctcaatatctggctggaacaagtggaaggtcagcagttgcgcgacgccattgaagaa
tacggtaacgctattcgccagcttgccgctgctaacattttccctggcgacatgctgttt
aaaaacttcggtgtcacccgtcacgggcgtgtggttttttatgattacgatgaaatttgc
tacatgacggaagtgaatttccgcgacatcccgccgccgcgctatccggaagacgaactt
gccagcgaaccgtggtacagcgtctcgccgggcgatgttttcccggaagagtttcgccac
tggctatgcgccgacccgcgtattggtccgctgtttgaagagatgcacgccgacctgttc
cgcgctgattactggcgcgcactacaaaaccgcatacgtgaagggcatgtggaagatgtt
tatgcgtatcggcgcaggcaaagatttagcgtacggtatggggagatgcttttttga

DBGET integrated database retrieval system