KEGG   Escherichia coli K-12 MG1655: b4022Help
Entry
b4022             CDS       T00007                                 

Gene name
rluF
Definition
(RefSeq) 23S rRNA pseudouridine(2604) synthase
  KO
K06182  
23S rRNA pseudouridine2604 synthase [EC:5.4.99.21]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.21  23S rRNA pseudouridine2604 synthase
     b4022 (rluF)
Ribosome biogenesis [BR:eco03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    b4022 (rluF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4230354..4231226
Genome map
AA seq 290 aa AA seqDB search
MLPDSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVVKVNGQLIE
PREAEDLVLIALNKPVGIVSTTEDGERDNIVDFVNHSKRVFPIGRLDKDSQGLIFLTNHG
DLVNKILRAGNDHEKEYLVTVDKPITEEFIRGMSAGVPILGTVTKKCKVKKEAPFVFRIT
LVQGLNRQIRRMCEHFGYEVKKLERTRIMNVSLSGIPLGEWRDLTDDELIDLFKLIENSS
SEVKPKAKAKPKTAGIKRPVVKMEKTAEKGGRPASNGKRFTSPGRKKKGR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgactcatcagtccgtttaaataaatacatcagcgaaagcggaatttgctca
cgccgcgaagcggatcgctatatcgagcaaggcaatgtgttccttaatggcaagcgagcc
accattggcgatcaggtgaaacccggcgacgttgtgaaagtaaacggtcagttgattgaa
cctcgggaagccgaagatttggtacttatcgccctgaacaagcccgttggtattgtaagc
accaccgaagatggcgagcgcgataacattgtcgatttcgttaaccacagcaaacgcgtg
ttcccgattggccgcctggataaagactcccaggggctgattttcctcaccaatcacggc
gatctggtgaataagatcctgcgtgctggcaatgatcatgagaaagagtatctggtgacg
gtcgataaaccgattaccgaggagtttattcgcggcatgagtgcgggggtgccaatcctc
gggacagtgaccaaaaagtgcaaagttaaaaaagaagcgccgtttgtcttccgcattacc
ctggtgcaggggctgaaccgtcagatccggcgcatgtgcgagcatttcggctatgaagtg
aaaaagctggaacgcacgcgcatcatgaacgttagcttaagcggcattccgctgggggaa
tggcgcgatttaaccgacgatgagttaatcgacctctttaagctcattgaaaattcctct
tccgaggtaaaacctaaagcgaaggccaaaccgaaaacagcgggcatcaaacgtccagtc
gttaagatggaaaaaacggcggaaaaaggcggtcgcccggcgtccaacggtaagcgtttt
acctcgccggggcgtaaaaagaaggggcgctga

DBGET integrated database retrieval system