KEGG   Escherichia coli K-12 MG1655: b4023Help
Entry
b4023             CDS       T00007                                 

Gene name
yjbD
Definition
(RefSeq) DUF3811 family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4231359..4231631)
Genome map
AA seq 90 aa AA seqDB search
MALPRITQKEMTEREQRELKTLLDRARIAHGRVLTNSETNSIKKDYIDKLMVEREAEAKK
ARQLKKKQAYKPDPEASFSWSANTSTRGRR
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggcactcccccgtattacccaaaaagagatgactgaacgcgagcagcgtgaacttaaa
acactgctggatcgggcgcggattgcgcatggtcgcgtattgaccaactccgaaaccaac
agcattaagaaagattacatcgataaattaatggttgagcgtgaggctgaagcgaaaaaa
gcccgccagttgaagaaaaagcaggcttataaaccggatcctgaagcgtcatttagctgg
tcagcaaatacgtcgacgcgcggcaggcgctaa

DBGET integrated database retrieval system