KEGG   Escherichia coli K-12 MG1655: b4024Help
Entry
b4024             CDS       T00007                                 

Gene name
lysC
Definition
(RefSeq) lysine-sensitive aspartokinase 3
  KO
K00928  
aspartate kinase [EC:2.7.2.4]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycine, serine and threonine metabolism
Monobactam biosynthesis
Cysteine and methionine metabolism
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Methionine biosynthesis, apartate => homoserine => methionine
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b4024 (lysC)
   00270 Cysteine and methionine metabolism
    b4024 (lysC)
   00300 Lysine biosynthesis
    b4024 (lysC)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    b4024 (lysC)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     b4024 (lysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4231884..4233233)
Genome map
AA seq 449 aa AA seqDB search
MSEIVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALAEGLEPGER
FEKLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGEL
MSTLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVI
TQGFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRI
DEIAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFR
ALALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTS
TGDTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICY
GASSHNLCFLVPGEDAEQVVQKLHSNLFE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattgttgtctccaaatttggcggtaccagcgtagctgattttgacgccatg
aaccgcagcgctgatattgtgctttctgatgccaacgtgcgtttagttgtcctctcggct
tctgctggtatcactaatctgctggtcgctttagctgaaggactggaacctggcgagcga
ttcgaaaaactcgacgctatccgcaacatccagtttgccattctggaacgtctgcgttac
ccgaacgttatccgtgaagagattgaacgtctgctggagaacattactgttctggcagaa
gcggcggcgctggcaacgtctccggcgctgacagatgagctggtcagccacggcgagctg
atgtcgaccctgctgtttgttgagatcctgcgcgaacgcgatgttcaggcacagtggttt
gatgtacgtaaagtgatgcgtaccaacgaccgatttggtcgtgcagagccagatatagcc
gcgctggcggaactggccgcgctgcagctgctcccacgtctcaatgaaggcttagtgatc
acccagggatttatcggtagcgaaaataaaggtcgtacaacgacgcttggccgtggaggc
agcgattatacggcagccttgctggcggaggctttacacgcatctcgtgttgatatctgg
accgacgtcccgggcatctacaccaccgatccacgcgtagtttccgcagcaaaacgcatt
gatgaaatcgcgtttgccgaagcggcagagatggcaacttttggtgcaaaagtactgcat
ccggcaacgttgctacccgcagtacgcagcgatatcccggtctttgtcggctccagcaaa
gacccacgcgcaggtggtacgctggtgtgcaataaaactgaaaatccgccgctgttccgc
gctctggcgcttcgtcgcaatcagactctgctcactttgcacagcctgaatatgctgcat
tctcgcggtttcctcgcggaagttttcggcatcctcgcgcggcataatatttcggtagac
ttaatcaccacgtcagaagtgagcgtggcattaacccttgataccaccggttcaacctcc
actggcgatacgttgctgacgcaatctctgctgatggagctttccgcactgtgtcgggtg
gaggtggaagaaggtctggcgctggtcgcgttgattggcaatgacctgtcaaaagcctgc
ggcgttggcaaagaggtattcggcgtactggaaccgttcaacattcgcatgatttgttat
ggcgcatccagccataacctgtgcttcctggtgcccggcgaagatgccgagcaggtggtg
caaaaactgcatagtaatttgtttgagtaa

DBGET integrated database retrieval system