KEGG   Escherichia coli K-12 MG1655: b4034Help
Entry
b4034             CDS       T00007                                 

Gene name
malE
Definition
(RefSeq) maltose transporter subunit
  KO
K10108  
maltose/maltodextrin transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Bacterial chemotaxis
Module
Maltose/maltodextrin transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b4034 (malE)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    b4034 (malE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    b4034 (malE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4245229..4246419)
Genome map
AA seq 396 aa AA seqDB search
MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK
VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW
DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP
YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE
AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE
LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP
QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaaaacaggtgcacgcatcctcgcattatccgcattaacgacgatgatgttt
tccgcctcggctctcgccaaaatcgaagaaggtaaactggtaatctggattaacggcgat
aaaggctataacggtctcgctgaagtcggtaagaaattcgagaaagataccggaattaaa
gtcaccgttgagcatccggataaactggaagagaaattcccacaggttgcggcaactggc
gatggccctgacattatcttctgggcacacgaccgctttggtggctacgctcaatctggc
ctgttggctgaaatcaccccggacaaagcgttccaggacaagctgtatccgtttacctgg
gatgccgtacgttacaacggcaagctgattgcttacccgatcgctgttgaagcgttatcg
ctgatttataacaaagatctgctgccgaacccgccaaaaacctgggaagagatcccggcg
ctggataaagaactgaaagcgaaaggtaagagcgcgctgatgttcaacctgcaagaaccg
tacttcacctggccgctgattgctgctgacgggggttatgcgttcaagtatgaaaacggc
aagtacgacattaaagacgtgggcgtggataacgctggcgcgaaagcgggtctgaccttc
ctggttgacctgattaaaaacaaacacatgaatgcagacaccgattactccatcgcagaa
gctgcctttaataaaggcgaaacagcgatgaccatcaacggcccgtgggcatggtccaac
atcgacaccagcaaagtgaattatggtgtaacggtactgccgaccttcaagggtcaacca
tccaaaccgttcgttggcgtgctgagcgcaggtattaacgccgccagtccgaacaaagag
ctggcgaaagagttcctcgaaaactatctgctgactgatgaaggtctggaagcggttaat
aaagacaaaccgctgggtgccgtagcgctgaagtcttacgaggaagagttggcgaaagat
ccacgtattgccgccaccatggaaaacgcccagaaaggtgaaatcatgccgaacatcccg
cagatgtccgctttctggtatgccgtgcgtactgcggtgatcaacgccgccagcggtcgt
cagactgtcgatgaagccctgaaagacgcgcagactcgtatcaccaagtaa

DBGET integrated database retrieval system