KEGG   Escherichia coli K-12 MG1655: b4035Help
Entry
b4035             CDS       T00007                                 

Gene name
malK
Definition
(RefSeq) maltose ABC transportor ATPase
  KO
K10111  
multiple sugar transport system ATP-binding protein [EC:3.6.3.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Maltose/maltodextrin transport system
Putative multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b4035 (malK)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     b4035 (malK)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter [MD:M00194] [OT]
    b4035 (malK)
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    b4035 (malK)
   Trehalose/maltose transporter [MD:M00204] [OT]
    b4035 (malK)
   Putative sorbitol/mannitol transporter [MD:M00200] [OT]
    b4035 (malK)
   Putative multiple sugar transporter [MD:M00207]
    b4035 (malK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4246784..4247899
Genome map
AA seq 371 aa AA seqDB search
MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL
FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV
LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLH
KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN
FLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVIL
EGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGT
ACRRLHKEPGV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgtacagctgcaaaatgtaacgaaagcctggggcgaggtcgtggtatcgaaa
gatatcaatctcgatatccatgaaggtgaattcgtggtgtttgtcggaccgtctggctgc
ggtaaatcgactttactgcgcatgattgccgggcttgagacgatcaccagcggcgacctg
ttcatcggtgagaaacggatgaatgacactccgccagcagaacgcggcgttggtatggtg
tttcagtcttacgcgctctatccccacctgtcagtagcagaaaacatgtcatttggcctg
aaactggctggcgcaaaaaaagaggtgattaaccaacgcgttaaccaggtggcggaagtg
ctacaactggcgcatttgctggatcgcaaaccgaaagcgctctccggtggtcagcgtcag
cgtgtggcgattggccgtacgctggtggccgagccaagcgtatttttgctcgatgaaccg
ctctccaacctcgatgctgcactgcgtgtgcaaatgcgtatcgaaatctcccgtctgcat
aaacgcctgggccgcacaatgatttacgtcacccacgatcaggtcgaagcgatgacgctg
gccgacaaaatcgtggtgctggacgccggtcgcgtggcgcaggttgggaaaccgctggag
ctgtaccactatccggcagaccgttttgtcgccggatttatcggttcgccaaagatgaac
ttcctgccggtaaaagtgaccgccaccgcaatcgatcaagtgcaggtggagctgccgatg
ccaaatcgtcagcaagtctggctgccagttgaaagccgtgatgtccaggttggagccaat
atgtcgctgggtattcgcccggaacatctactgccgagtgatatcgctgacgtcatcctt
gagggtgaagttcaggtcgtcgagcaactcggcaacgaaactcaaatccatatccagatc
ccttccattcgtcaaaacctggtgtaccgccagaacgacgtggtgttggtagaagaaggt
gccacattcgctatcggcctgccgccagagcgttgccatctgttccgtgaggatggcact
gcatgtcgtcgactgcataaggagccgggcgtttaa

DBGET integrated database retrieval system