KEGG   Escherichia coli K-12 MG1655: b4053Help
Entry
b4053             CDS       T00007                                 

Gene name
alr
Definition
(RefSeq) alanine racemase, biosynthetic, PLP-binding (EC:5.1.1.1)
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    b4053 (alr)
 Human Diseases
  Antimicrobial resistance
   01502 Vancomycin resistance
    b4053 (alr)
Enzymes [BR:eco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     b4053 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4265782..4266861
Genome map
AA seq 359 aa AA seqDB search
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcggcaactgttgtgattaaccgccgcgctctgcgacacaacctgcaacgtctt
cgtgaactggcccctgccagtaaaatggttgcggtggtgaaagcgaacgcttatggtcac
ggtcttcttgagaccgcgcgaacgctccccgatgctgacgcctttggcgtagcccgtctc
gaagaagctctgcgactgcgtgcggggggaatcaccaaacctgtactgttactcgaaggc
ttttttgatgccagagatctgccgacgatttctgcgcaacattttcataccgccgtgcat
aacgaagaacagctggctgcgctggaagaggctagcctggacgagccggttaccgtctgg
atgaaactcgataccggtatgcaccgtctgggcgtaaggccggaacaggctgaggcgttt
tatcatcgcctgacccagtgcaaaaacgttcgtcagccggtgaatatcgtcagccatttt
gcgcgcgcggatgaaccaaaatgtggcgcaaccgagaaacaactcgctatctttaatacc
ttttgcgaaggcaaacctggtcaacgttccattgccgcgtcgggtggcattctgctgtgg
ccacagtcgcattttgactgggtgcgcccgggcatcattctttatggcgtctcgccgctg
gaagatcgctccaccggtgccgattttggctgtcagccagtgatgtcactaacctccagc
ctgattgccgtgcgtgagcataaagccggagagcctgttggttatggtggaacctgggta
agcgaacgtgatacccgtcttggcgtagtcgcgatgggctatggcgatggttatccgcgc
gccgcgccgtccggtacgccagtgctggtgaacggtcgcgaagtaccgattgtcgggcgc
gtggcgatggatatgatctgcgtagacttaggtccacaggcgcaggacaaagccggggat
ccggtcattttatggggcgaaggtttgcccgtagaacgtatcgctgaaatgacgaaagta
agcgcttacgaacttattacgcgcctgacttcaagggtcgcgatgaaatacgtggattaa

DBGET integrated database retrieval system