KEGG   Escherichia coli K-12 MG1655: b4055Help
Entry
b4055             CDS       T00007                                 

Gene name
aphA
Definition
(RefSeq) acid phosphatase/phosphotransferase, class B, non-specific
  KO
K03788  
acid phosphatase (class B) [EC:3.1.3.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    b4055 (aphA)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     b4055 (aphA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4269414..4270127
Genome map
AA seq 237 aa AA seqDB search
MRKITQAISAVCLLFALNSSAVALASSPSPLNPGTNVARLAEQAPIHWVSVAQIENSLAG
RPPMAVGFDIDDTVLFSSPGFWRGKKTFSPESEDYLKNPVFWEKMNNGWDEFSIPKEVAR
QLIDMHVRRGDAIFFVTGRSPTKTETVSKTLADNFHIPATNMNPVIFAGDKPGQNTKSQW
LQDKNIRIFYGDSDNDITAARDVGARGIRILRASNSTYKPLPQAGAFGEEVIVNSEY
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagatcacacaggcaatcagtgccgtttgcttattgttcgctctaaacagttcc
gctgttgccctggcctcatctccttcaccgcttaaccctgggactaacgttgccaggctt
gctgaacaggcacccattcattgggtttcggtcgcacaaattgaaaatagcctcgcaggg
cgtccgccaatggcggtggggtttgatatcgatgacacggtacttttttccagtccgggc
ttctggcgcggcaaaaaaaccttctcgccagaaagcgaagattatctgaaaaatcctgtg
ttctgggaaaaaatgaacaatggctgggatgaattcagcattccaaaagaggtcgctcgc
cagctgattgatatgcatgtacgccgcggtgacgcgatcttctttgtgactggtcgtagc
ccgacgaaaacagaaacggtttcaaaaacgctggcggataattttcatattcctgccacc
aacatgaatccggtgatctttgcgggcgataaaccagggcaaaatacaaaatcgcaatgg
ctgcaggataaaaatatccgaattttttatggcgattctgataatgatattaccgccgca
cgcgatgtcggcgctcgtggtatccgcattctgcgcgcctccaactctacctacaaaccc
ttgccacaagcgggtgcgtttggtgaagaggtgatcgtcaattcagaatactga

DBGET integrated database retrieval system