KEGG   Escherichia coli K-12 MG1655: b4056Help
Entry
b4056             CDS       T00007                                 

Gene name
yjbQ
Definition
(RefSeq) thiamine phosphate synthase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0047
Motif
Other DBs
NCBI-GeneID: 948561
NCBI-ProteinID: NP_418480
Pasteur: yjbQ
RegulonDB: ECK120001863
ECOCYC: EG11935
ASAP: ABE-0013286
UniProt: P0AF48
Position
4270238..4270654
Genome map
AA seq 138 aa AA seqDB search
MWYQKTLTLSAKSRGFHLVTDEILNQLADMPRVNIGLLHLLLQHTSASLTLNENCDPTVR
HDMERFFLRTVPDNGNYEHDYEGADDMPSHIKSSMLGTSLVLPVHKGRIQTGTWQGIWLG
EHRIHGGSRRIIATLQGE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatcaaaagacgctcacgcttagcgccaaatctcgtgggtttcatctggtaacg
gatgaaattctgaatcagctggctgatatgccgcgcgttaacatcggcttactgcatctg
ttgctgcaacatacctccgcctctctgacacttaatgagaactgcgatcccaccgtacgc
cacgacatggagcgttttttcctccgcaccgttcccgacaacggaaattatgagcatgac
tatgagggagcagacgatatgccttctcatatcaaatcctcaatgctgggaacatcgctt
gtattgccggtgcataaagggcgtattcagaccggcacctggcaaggcatttggctgggg
gaacatcgcatccacggcggatcgcgtcgcatcatcgcgacactacaaggggagtaa

DBGET integrated database retrieval system