KEGG   Escherichia coli K-12 MG1655: b4056Help
Entry
b4056             CDS       T00007                                 

Gene name
yjbQ
Definition
(RefSeq) thiamine phosphate synthase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4270238..4270654
Genome map
AA seq 138 aa AA seqDB search
MWYQKTLTLSAKSRGFHLVTDEILNQLADMPRVNIGLLHLLLQHTSASLTLNENCDPTVR
HDMERFFLRTVPDNGNYEHDYEGADDMPSHIKSSMLGTSLVLPVHKGRIQTGTWQGIWLG
EHRIHGGSRRIIATLQGE
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatcaaaagacgctcacgcttagcgccaaatctcgtgggtttcatctggtaacg
gatgaaattctgaatcagctggctgatatgccgcgcgttaacatcggcttactgcatctg
ttgctgcaacatacctccgcctctctgacacttaatgagaactgcgatcccaccgtacgc
cacgacatggagcgttttttcctccgcaccgttcccgacaacggaaattatgagcatgac
tatgagggagcagacgatatgccttctcatatcaaatcctcaatgctgggaacatcgctt
gtattgccggtgcataaagggcgtattcagaccggcacctggcaaggcatttggctgggg
gaacatcgcatccacggcggatcgcgtcgcatcatcgcgacactacaaggggagtaa

DBGET integrated database retrieval system