KEGG   Escherichia coli K-12 MG1655: b4058Help
Entry
b4058             CDS       T00007                                 

Gene name
uvrA
Definition
(RefSeq) ATPase and DNA damage recognition protein of nucleotide excision repair excinuclease UvrABC
  KO
K03701  excinuclease ABC subunit A
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    b4058 (uvrA)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     b4058 (uvrA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      b4058 (uvrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_29 AAA_16 RsgA_GTPase DnaJ_CXXCXGXG AAA_23 AAA_25 cobW NACHT Viral_helicase1 DUF2075 DUF2083
Motif
Other DBs
NCBI-GeneID: 948559
NCBI-ProteinID: NP_418482
Pasteur: uvrA
RegulonDB: ECK120001050
ECOCYC: EG11061
ASAP: ABE-0013290
UniProt: P0A698
Structure
PDB: 

Jmol
Position
complement(4271049..4273871)
Genome map
AA seq 940 aa AA seqDB search
MDKIEVRGARTHNLKNINLVIPRDKLIVVTGLSGSGKSSLAFDTLYAEGQRRYVESLSAY
ARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEIHDYLRLLFARVGEPRC
PDHDVPLAAQTVSQMVDNVLSQPEGKRLMLLAPIIKERKGEHTKTLENLASQGYIRARID
GEVCDLSDPPKLELQKKHTIEVVVDRFKVRDDLTQRLAESFETALELSGGTAVVADMDDP
KAEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCDGLGVQQYFDPDRVIQNPEL
SLAGGAIRGWDRRNFYYFQMLKSLADHYKFDVEAPWGSLSANVHKVVLYGSGKENIEFKY
MNDRGDTSIRRHPFEGVLHNMERRYKETESSAVREELAKFISNRPCASCEGTRLRREARH
VYVENTPLPAISDMSIGHAMEFFNNLKLAGQRAKIAEKILKEIGDRLKFLVNVGLNYLTL
SRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSIGLHQRDNERLLGTLIHLRDLGNT
VIVVEHDEDAIRAADHVIDIGPGAGVHGGEVVAEGPLEAIMAVPESLTGQYMSGKRKIEV
PKKRVPANPEKVLKLTGARGNNLKDVTLTLPVGLFTCITGVSGSGKSTLINDTLFPIAQR
QLNGATIAEPAPYRDIQGLEHFDKVIDIDQSPIGRTPRSNPATYTGVFTPVRELFAGVPE
SRARGYTPGRFSFNVRGGRCEACQGDGVIKVEMHFLPDIYVPCDQCKGKRYNRETLEIKY
KGKTIHEVLDMTIEEAREFFDAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKL
ARELSKRGTGQTLYILDEPTTGLHFADIQQLLDVLHKLRDQGNTIVVIEHNLDVIKTADW
IVDLGPEGGSGGGEILVSGTPETVAECEASHTARFLKPML
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggataagatcgaagttcggggcgcccgcacccataatctcaaaaacatcaacctcgtt
atcccccgcgacaagctcattgtcgtgaccgggctttcgggttctggcaaatcctcgctc
gctttcgacaccttatatgccgaagggcagcgccgttacgttgaatccctttccgcctac
gcgcggcagtttctgtcactgatggaaaagccggacgtcgatcatattgaggggctttct
cctgccatctcaattgagcagaaatcgacgtctcataacccgcgttctacggtggggaca
atcaccgaaatccacgactatttgcgtttgttattcgcccgcgttggcgagccgcgctgt
ccggaccacgacgtcccgctggcggcgcaaaccgtcagccagatggtggataacgtgctg
tcgcagccggaaggcaagcgtctgatgctactcgcgccaatcattaaagagcgcaaaggc
gaacacaccaaaacgctggagaacctggcaagccagggctacatccgtgctcgtattgat
ggcgaagtctgcgatctttccgatccgccaaaactggaactgcaaaagaaacataccatt
gaagtggtggttgatcgcttcaaggtgcgtgacgatcttacccaacgtcttgccgagtca
tttgaaaccgcgctggagctttccggtggtaccgcggtagtggcggatatggacgacccg
aaagcggaagagctgctgttctccgccaacttcgcctgcccaatttgcggctacagtatg
cgtgaactggagccgcgactgttttcgtttaacaacccggcgggggcctgcccgacctgc
gacggccttggcgtacagcaatatttcgatcctgatcgagtgatccagaatccggaactg
tcgctggctggtggtgcgatccgtggctgggatcgccgcaacttctattatttccagatg
ctgaaatcgctggcagatcactataagttcgacgtcgaagcgccgtggggcagcctgagc
gcgaacgtgcataaagtggtgttgtacggttctggcaaagaaaacattgaattcaaatac
atgaacgatcgtggcgatacctccattcgtcgtcatccgttcgaaggcgtgctgcataat
atggagcgccgctataaagagacggaatccagcgcggtacgcgaagaattagccaagttt
atcagtaatcgtccgtgcgccagctgcgaagggacgcgtctgcgtcgggaagcgcgccac
gtgtatgtcgagaatacgccgctgcctgctatctccgacatgagcattggtcatgcgatg
gaattcttcaacaatctcaaactcgcaggtcagcgggcgaagattgcagaaaaaatcctt
aaagagatcggcgatcgtctgaaattcctcgttaacgtcggcctgaattacctgacgctt
tcccgctcggcagaaacgctttctggcggtgaagcacagcgtatccgtctggcgagccag
attggtgcgggcctggttggcgttatgtacgtgctggacgagccgtctatcggcctgcac
cagcgtgataacgagcgcctgttgggtacgcttatccatctgcgcgatctcggtaatacc
gtgattgtggtggagcacgacgaagacgcaattcgcgccgctgaccatgtgatcgacatt
ggcccgggcgcaggtgttcacggcggtgaagtggtcgcagaaggtccgctggaagcgatt
atggcggtgccggagtcgttgaccgggcagtacatgagcggcaaacgcaagattgaagtg
ccgaagaaacgcgttccggcgaatccggaaaaagtgctgaagctgacaggcgcacgcggc
aacaacctgaaggacgtgacgctgacgctgccggtgggtctgtttacctgcatcaccggg
gtttcaggttccggtaaatcgacgctgattaacgacacactgttcccgattgcccaacgc
cagttgaatggggcgaccatcgccgaaccagcaccgtatcgcgatattcaggggctggag
catttcgataaagtgatcgatatcgaccaaagcccaattggtcgtactccacgttctaac
ccggcgacctataccggcgtgtttacgcctgtgcgcgaactgtttgcgggcgtaccggaa
tcccgtgcgcgcggctatacgccgggacgtttcagctttaacgttcgtggcggacgctgc
gaggcctgtcagggcgatggcgtgatcaaagtggagatgcacttcctgccggatatctac
gtgccgtgcgaccagtgcaaaggtaaacgctataaccgtgaaacgctggagattaagtac
aaaggcaaaaccatccacgaagtgctggatatgaccatcgaagaggcgcgtgagttcttt
gatgccgtacctgcactggcgcgtaagctgcaaacgttgatggacgttggcctgacgtac
attcgactggggcagtccgcaaccaccctttcaggcggtgaagcccagcgcgtgaagctg
gcgcgtgaactgtcaaaacgcggcaccgggcagacgctgtatattctcgacgagccgacc
accggtctgcacttcgccgatattcagcaactgctcgacgtactgcataaactgcgcgat
cagggcaacaccattgtggtgattgagcacaatctcgacgtgatcaaaaccgctgactgg
attgtcgacctgggaccagaaggcggcagtggtggcggcgagatcctcgtctccggtacg
ccagaaaccgtcgcggagtgcgaagcatcacacacggcacgcttccttaagccgatgctg
taa

DBGET integrated database retrieval system