KEGG   Escherichia coli K-12 MG1655: b4060Help
Entry
b4060             CDS       T00007                                 

Gene name
yjcB
Definition
(RefSeq) putative inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjcB
Motif
Other DBs
NCBI-GeneID: 948569
NCBI-ProteinID: NP_418484
Pasteur: yjcB
RegulonDB: ECK120001865
ECOCYC: EG11937
ASAP: ABE-0013300
UniProt: P32700
Position
complement(4274760..4275041)
Genome map
AA seq 93 aa AA seqDB search
MATLTTGVVLLRWQLLSAVMMFLASTLNIRFRRSDYVGLAVISSGLGVVSACWFAMGLLG
ITMADITAIWHNIESVMIEEMNQTPPQWPMILT
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggctaccctcaccactggcgtggttcttcttcgctggcaacttcttagtgccgtaatg
atgtttctggccagcacactcaacatccgttttcgtcggtctgattatgtcgggcttgcg
gtgatcagcagcggtctgggcgttgtttccgcctgttggttcgcaatggggttgcttggc
atcacaatggcggacatcaccgctatctggcacaacatcgagtcggtgatgatagaagag
atgaatcagacaccgccacaatggccaatgattttgacctga

DBGET integrated database retrieval system