KEGG   Escherichia coli K-12 MG1655: b4061Help
Entry
b4061             CDS       T00007                                 

Gene name
yjcC
Definition
(RefSeq) putative membrane-anchored cyclic-di-GMP phosphodiesterase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ASAP: 
UniProt: 
Position
4275471..4277057
Genome map
AA seq 528 aa AA seqDB search
MSHRARHQLLALPGIIFLVLFPIILSLWIAFLWAKSEVNNQLRTFAQLALDKSELVIRQA
DLVSDAAERYQGQVCTPAHQKRMLNIIRGYLYINELIYARDNHFLCSSLIAPVNGYTIAP
ADYKREPNVSIYYYRDTPFFSGYKMTYMQRGNYVAVINPLFWSEVMSDDPTLQWGVYDTV
TKTFFSLSKEASAATFSPLIHLKDLTVQRNGYLYATVYSTKRPIAAIVATSYQRLITHFY
NHLIFALPAGILGSLVLLLLWLRIRQNYLSPKRKLQRALEKHQLCLYYQPIIDIKTEKCI
GAEALLRWPGEQGQIMNPAEFIPLAEKEGMIEQITDYVIDNVFRDLGDYLATHADRYVSI
NLSASDFHTSRLIARINQKTEQYAVRPQQIKFEVTEHAFLDVDKMTPIILAFRQAGYEVA
IDDFGIGYSNLHNLKSLNVDILKIDKSFVETLTTHKTSHLIAEHIIELAHSLGLKTIAEG
VETEEQVNWLRKRGVRYCQGWFFAKAMPPQVFMQWMEQLPARELTRGQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcgtgcacgacaccaattactggcgttgccgggcattatctttttagttctc
tttcccatcattctttcgctatggattgccttcctttgggcaaaatcagaagtgaataat
cagctccgaacctttgctcaactggcactggataaatccgagctggtcattcgccaggca
gatttagtgagcgatgcagctgaacgctatcaggggcaagtttgcactccagcccatcaa
aagcgaatgttgaatattattcgtggctatctttatattaatgaattgatctatgcccgt
gataaccattttttatgctcatcgctgatagcgcctgtaaacggctatacgattgcaccg
gccgattataagcgtgaacctaacgtttctatctattattaccgcgatacgccttttttc
tctggctataaaatgacctatatgcagcggggaaattatgtggcggttatcaaccctctc
ttctggagtgaagtgatgtctgatgacccgacattgcaatggggtgtgtatgatacggtg
acgaaaacctttttctcgttaagcaaagaggcctcggcagcaacgttttctccgctgatt
catttgaaggatttaaccgtacaaagaaatggctatttatatgcgacagtttattcgaca
aaacgcccaattgcagccattgttgcgacttcatatcaacgtcttataacccatttttat
aatcatcttatttttgcgttgcccgccggtattttggggagtcttgttctgctattactc
tggctacgtattcgacaaaactatttatctcccaaacgtaaattgcaacgcgccctcgaa
aaacatcaactttgtctttattaccagccaataatcgatatcaaaacagaaaaatgtatc
ggcgctgaagcgttgttacgttggcctggtgagcaggggcaaataatgaatccggcagag
tttattccgctggcagaaaaggaggggatgatagaacagataactgattatgttattgat
aatgtcttccgcgatctgggcgattacctggcaacacatgcagatcgctatgtttctatt
aacctgtcggcctccgattttcatacgtcacggttgatagcgcgaatcaatcagaaaaca
gagcaatacgcggtgcgtccgcagcaaattaaatttgaagtgactgagcatgcatttctt
gatgttgacaaaatgacgccgattattctggctttccgccaggcaggttacgaagtggca
attgatgattttggtattggctactctaacttgcataaccttaaatcattgaatgtcgat
attttgaaaatcgacaaatcgtttgttgaaacgctgaccacccacaaaaccagtcatttg
attgcggaacacatcatcgagctggcgcacagcctggggttaaaaacgatcgctgaaggc
gtcgaaactgaggagcaggttaactggctgcgcaaacgcggcgtgcgctattgccaggga
tggttctttgcgaaggcgatgccgccgcaggtgtttatgcaatggatggagcaattaccc
gcgcgggagttaacgcgcgggcaataa

DBGET integrated database retrieval system