KEGG   Escherichia coli K-12 MG1655: b4062Help
Entry
b4062             CDS       T00007                                 

Gene name
soxS
Definition
(RefSeq) superoxide response regulon transcriptional activator; autoregulator
  KO
K13631  
AraC family transcriptional regulator, mar-sox-rob regulon activator
Organism
eco  Escherichia coli K-12 MG1655
Module
Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    b4062 (soxS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4277060..4277383)
Genome map
AA seq 107 aa AA seqDB search
MSHQKIIQDLIAWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTVTHQTLGDYIRQRRLL
LAAVELRTTERPIFDIAMDLGYVSQQTFSRVFRRQFDRTPSDYRHRL
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatcagaaaattattcaggatcttatcgcatggattgacgagcatattgaccag
ccgcttaacattgatgtagtcgcaaaaaaatcaggctattcaaagtggtacttgcaacga
atgttccgcacggtgacgcatcagacgcttggcgattacattcgccaacgccgcctgtta
ctggccgccgttgagttgcgcaccaccgagcgtccgatttttgatatcgcaatggacctg
ggttatgtctcgcagcagaccttctcccgcgttttccgtcggcagtttgatcgcactccc
agcgattatcgccaccgcctgtaa

DBGET integrated database retrieval system