KEGG   Escherichia coli K-12 MG1655: b4063Help
Entry
b4063             CDS       T00007                                 

Gene name
soxR
Definition
(RefSeq) redox-sensitive transcriptional activator of soxS; autorepressor
  KO
K13639  
MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   MerR family
    b4063 (soxR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4277469..4277933
Genome map
AA seq 154 aa AA seqDB search
MEKKLPRIKALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAII
KIAQRIGIPLATIGEAFGVLPEGHTLSAKEWKQLSSQWREELDRRIHTLVALRDELDGCI
GCGCLSRSDCPLRNPGDRLGEEGTGARLLEDEQN
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaattaccccgcattaaagcgctgctaacccccggcgaagtggcgaaacgc
agcggtgtggcggtatcggcgctgcatttctatgaaagtaaagggttgattaccagtatc
cgtaacagcggcaatcagcggcgatataaacgtgatgtgttgcgatatgttgcaattatc
aaaattgctcagcgtattggcattccgctggcgaccattggtgaagcgtttggcgtgttg
cccgaagggcatacgttaagtgcgaaagagtggaaacagctttcgtcccaatggcgagaa
gagttggatcggcgcattcataccttagtggcgctgcgtgacgaactggacggatgtatt
ggttgtggctgcctttcgcgcagtgattgcccgttgcgtaacccgggcgaccgcttagga
gaagaaggtaccggcgcacgcttgctggaagatgaacaaaactaa

DBGET integrated database retrieval system