KEGG   Escherichia coli K-12 MG1655: b4064Help
Entry
b4064             CDS       T00007                                 

Gene name
yjcD
Definition
(RefSeq) inner membrane putative guanine permease
  KO
K06901  
putative MFS transporter, AGZA family, xanthine/uracil permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Purine transporter (AzgA) family [TC:2.A.1.40]
    b4064 (yjcD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ASAP: 
UniProt: 
Position
4278479..4279828
Genome map
AA seq 449 aa AA seqDB search
MSTPSARTGGSLDAWFKISQRGSTVRQEVVAGLTTFLAMVYSVIVVPGMLGKAGFPPAAV
FVATCLVAGLGSIVMGLWANLPLAIGCAISLTAFTAFSLVLGQHISVPVALGAVFLMGVL
FTVISATGIRSWILRNLPHGVAHGTGIGIGLFLLLIAANGVGLVIKNPLDGLPVALGDFA
TFPVIMSLVGLAVIIGLEKLKVPGGILLTIIGISIVGLIFDPNVHFSGVFAMPSLSDENG
NSLIGSLDIMGALNPVVLPSVLALVMTAVFDATGTIRAVAGQANLLDKDGQIIDGGKALT
TDSMSSVFSGLVGAAPAAVYIESAAGTAAGGKTGLTAITVGVLFLLILFLSPLSYLVPGY
ATAPALMYVGLLMLSNVAKIDFADFVDAMAGLVTAVFIVLTCNIVTGIMIGFATLVIGRL
VSGEWRKLNIGTVVIAVALVTFYAGGWAI
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctacgccatcagcgcgtaccggcggttcactcgacgcctggtttaaaatttcacaa
cgtggaagcactgtccgtcaggaagtggttgccgggttaacaacgtttctggcgatggtc
tactcggtcatcgtcgttccaggtatgttgggtaaagcaggcttcccgcctgcggcagtt
ttcgttgcaacctgtctggttgccggactcggttctatcgtgatgggtctgtgggctaat
ctgccgttggcgattggttgcgccatctccctgacagcgtttaccgcattcagcctggtg
ctggggcaacatattagcgtacctgtcgcgctgggtgccgtgttcctgatgggtgtgctg
tttacggtaatttctgccacgggtatccgtagctggattttgcgcaacttgcctcacggt
gtggcgcacggcacggggattggtatcggtctgttcctgctgctcattgccgctaacggt
gtcggtctggtgattaaaaacccgcttgatggtctgcccgttgcgctgggtgatttcgcg
accttcccggtgattatgtcactggtaggtctggcggtgatcatcggcctggaaaaactg
aaagtccctggtggcattctgctgaccattatcggtatctcaattgtcggtttgatcttc
gatcctaacgtccatttctccggcgttttcgccatgccttcattgagcgatgaaaacggc
aattcactgattggcagcctggacattatgggcgcgctgaatcctgtagtcctgccaagc
gttctggcgctggtgatgacggcagtatttgatgccaccggaactatccgtgccgtcgcc
ggccaggcgaacctgctggataaagatgggcagatcatcgacggtgggaaagcactgacc
actgactccatgagcagcgttttctctggcctggtgggtgcggctccggcagcggtatac
atcgagtctgcggcgggtacggcggcgggcggtaaaaccggtttgacggctatcaccgtt
ggcgtgctgttcctcctgattctgttcctctctccgctctcttacctcgttccggggtat
gcaacggctccggcgctgatgtacgttggcctgctgatgctgagcaacgtggcgaaaatc
gactttgctgattttgttgatgcgatggcgggtctggttacggctgtattcatcgtgctg
acctgtaacatcgtaacaggcatcatgatcggcttcgcgactctggtgattggtcgtctg
gtttccggcgaatggcgcaagttgaacatcggtacggtcgttatcgccgtggcgctggtg
accttctatgcgggtggctgggctatctaa

DBGET integrated database retrieval system