KEGG   Escherichia coli K-12 MG1655: b4065Help
Entry
b4065             CDS       T00007                                 

Gene name
yjcE
Definition
(RefSeq) putative cation/proton antiporter
  KO
K03316  monovalent cation:H+ antiporter, CPA1 family
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger
Motif
Other DBs
NCBI-GeneID: 948577
NCBI-ProteinID: NP_418489
Pasteur: yjcE
RegulonDB: ECK120001868
ECOCYC: EG11940
ASAP: ABE-0013323
UniProt: P32703
Position
4279980..4281629
Genome map
AA seq 549 aa AA seqDB search
MEIFFTILIMTLVVSLSGVVTRVMPFQIPLPLMQIAIGALLAWPTFGLHVEFDPELFLVL
FIPPLLFADGWKTPTREFLEHGREIFGLALALVVVTVVGIGFLIYWVVPGIPLIPAFALA
AVLSPTDAVALSGIVGEGRIPKKIMGILQGEALMNDASGLVSLKFAVAVAMGTMIFTVGG
ATVEFMKVAIGGILAGFVVSWLYGRSLRFLSRWGGDEPATQIVLLFLLPFASYLIAEHIG
VSGILAAVAAGMTITRSGVMRRAPLAMRLRANSTWAMLEFVFNGMVFLLLGLQLPGILET
SLMAAEIDPNVEIWMLFTNIILIYAALMLVRFGWLWTMKKFSNRFLKKKPMEFGSWTTRE
ILIASFAGVRGAITLAGVLSIPLLLPDGNVFPARYELVFLAAGVILFSLFVGVVMLPILL
QHIEVADHSQQLKEERIARAATAEVAIVAIQKMEERLAADTEENIDNQLLTEVSSRVIGN
LRRRADGRNDVESSVQEENLERRFRLAALRSERAELYHLRATREISNETLQKLLHDLDLL
EALLIEENQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcttcttcaccatactgataatgaccctcgtggtctcgctgtccggggtggtc
actcgtgtcatgccctttcagatcccgcttccgcttatgcaaatcgccatcggtgcgcta
ctggcgtggccgacgtttggtttgcatgtggagtttgatcctgaactctttttagtcttg
tttatcccgccgttgctgttcgctgatggctggaaaacgccgacccgtgaatttctcgaa
catggtcgagagattttcggcctcgcgctggcgctggtggtggtcaccgtggtcggcatt
ggcttccttatttactgggtggtgccgggcattccgctgatccctgcctttgcgctggcg
gcggtgctttctccgaccgatgctgtggcgctctccgggattgttggcgaagggcgcatc
ccgaaaaaaatcatgggcattttgcagggcgaagcgttgatgaatgacgcctccggtctg
gtgtcgttgaagtttgccgtagcagtggcgatggggacgatgatcttcaccgtcggcggt
gcgacggtcgaatttatgaaagtagccattggcggtattctcgccggttttgtggtgagc
tggctgtacggtcgctcgctgcgattcctcagccgctggggcggtgatgaacccgcgacg
cagatcgtcctgctgttcctgctgccattcgcttcttatctgattgccgaacatattggc
gtttccggcatcctcgctgcggttgccgccgggatgaccatcacccgctccggtgtgatg
cgccgtgcgccgctggcaatgcgcctgcgtgcaaacagcacctgggcgatgctggaattt
gtctttaacggcatggtgttcctgctgttaggtctgcagctgccgggtattctggagacg
tcgctgatggcagcagaaatcgaccctaacgtcgaaatctggatgctgtttaccaatatt
attctgatatatgcggcgctgatgctggtccgtttcggctggctgtggacgatgaaaaag
ttcagcaaccgcttcctgaagaagaagccgatggagtttggttcgtggaccacacgagaa
atcctgatcgcgtctttcgccggggtgcgtggggcgatcactctggccggtgtgctctct
atcccgctgctcttgccggatggtaacgtcttcccggcgcgctatgagctggtgttcctg
gcggctggcgtcattctcttctcgctgtttgtcggcgtggtgatgttgcctattctgcta
caacacattgaagtcgcggatcattcgcaacaattgaaagaggaacgtattgcgcgagcg
gcaacggcagaagtggcgattgtggcgatccagaaaatggaggagcgtctggcggcggat
accgaagagaatatcgataaccagctgcttacggaggtcagttctcgcgtcattggtaac
ctgcgtcgtcgcgccgatggacgtaacgacgttgaaagttccgtgcaggaagagaacctt
gagcgtcgcttccgtctggcggcattgcgttctgaacgtgctgaactttaccacctgcgc
gccacacgggagatcagcaacgaaacgctgcaaaaattactgcacgatctcgatttgctt
gaagcgttgctaattgaggaaaatcagtaa

DBGET integrated database retrieval system