KEGG   Escherichia coli K-12 MG1655: b4068Help
Entry
b4068             CDS       T00007                                 

Gene name
yjcH
Definition
(RefSeq) DUF485 family inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4284899..4285213)
Genome map
AA seq 104 aa AA seqDB search
MNGTIYQRIEDNAHFRELVEKRQRFATILSIIMLAVYIGFILLIAFAPGWLGTPLNPNTS
VTRGIPIGVGVIVISFVLTGIYIWRANGEFDRLNNEVLHEVQAS
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcactatttatcagcggatagaagacaatgcgcatttcagggagttagtcgaa
aaacggcaacggtttgccaccatcctgtcgattattatgctggcagtttatatcggcttt
attttactgatcgccttcgcgcccggctggctgggcacgccgctgaatccgaacaccagc
gtcacacgcggtattccaattggtgttggagtgattgtgatctcctttgttctcaccggt
atctacatctggcgggcgaacggcgaattcgaccgtcttaataatgaagtcctgcatgag
gtacaagcatcatga

DBGET integrated database retrieval system