KEGG   Escherichia coli K-12 MG1655: b4071Help
Entry
b4071             CDS       T00007                                 

Gene name
nrfB
Definition
(RefSeq) nitrite reductase, formate-dependent, penta-heme cytochrome c
  KO
K04013  cytochrome c-type protein NrfB
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrome_C7 Paired_CXXCH_1 Cytochrome_C554 Cytochrom_c3_2 Cytochrom_CIII Cytochrom_C552 Cytochrom_NNT DUF1924 NapB FYVE_2
Motif
Other DBs
NCBI-GeneID: 948573
NCBI-ProteinID: NP_418495
Pasteur: nrfB
RegulonDB: ECK120001872
ECOCYC: EG11945
ASAP: ABE-0013344
UniProt: P0ABL1
Structure
PDB: 

Jmol
Position
4289245..4289811
Genome map
AA seq 188 aa AA seqDB search
MSVLRSLLTAGVLASGLLWSLNGITATPAAQASDDRYEVTQQRNPDAACLDCHKPDTEGM
HGKHASVINPNNKLPVTCTNCHGQPSPQHREGVKDVMRFNEPMYKVGEQNSVCMSCHLPE
QLQKAFWPHDVHVTKVACASCHSLHPQQDTMQTLSDKGRIKICVDCHSDQRTNPNFNPAS
VPLLKEQP
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtattacgttcgttattaactgccggggtgctggcgtcgggcctgttgtggagc
ctgaacggaattaccgctacccctgcggcgcaggcatctgatgatcgctacgaagttacc
cagcagcgtaacccggatgccgcctgtctggactgtcataaaccagataccgaaggtatg
catggaaaacatgcttccgttatcaacccgaataacaaactgccggtcacctgcaccaac
tgtcacggccagccatcaccgcaacaccgcgaaggggtgaaagatgtgatgcgctttaac
gagccgatgtacaaggttggagagcagaacagcgtctgtatgtcctgtcatctgccggaa
cagttgcaaaaagcgttctggccgcacgatgtccacgtaaccaaagtggcgtgcgccagc
tgccattccctgcatccacagcaagatacgatgcagacgttaagtgacaaaggacggatt
aagatttgcgtcgattgccacagcgatcagcgcaccaatccgaactttaacccggcgtct
gttccgttgcttaaggagcagccatga

DBGET integrated database retrieval system