KEGG   Escherichia coli K-12 MG1655: b4073Help
Entry
b4073             CDS       T00007                                 

Gene name
nrfD
Definition
(RefSeq) formate-dependent nitrite reductase, membrane subunit
  KO
K04015  
protein NrfD
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4290476..4291432
Genome map
AA seq 318 aa AA seqDB search
MTQTSAFHFESLVWDWPIAIYLFLIGISAGLVTLAVLLRRFYPQAGGADSTLLRTTLIVG
PGAVILGLLILVFHLTRPWTFWKLMFHYSFTSVMSMGVMLFQLYMVVLVLWLAKIFEHDL
LALQQRWLPKLGIVQKVLSLLTPVHRGLETLMLVLAVLLGAYTGFLLSALKSYPFLNNPI
LPVLFLFSGISSGAAVALIAMAIRQRSNPHSTEAQFVHRMEIPVVWGEIFLLVAFFVGLA
LGDDGKVRALVAALGGGFWTWWFWLGVAGLGLIVPMLLKPWVNRSSGIPAVLAACGASLV
GVLMLRFFILYAGQLTVA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagacttccgcatttcattttgaatcgctggtgtgggactggccgattgccatc
tacctgtttttgattggtatttctgctggtctggtgacgctggccgtgctgttacgtcgc
ttctacccgcaggcgggcggtgcagacagtacgttgctgcgcaccacgctgattgtcggg
ccgggcgcggtgatcctcggtctgttgatcctcgtcttccacctgacaagaccgtggacc
ttctggaagctgatgttccactacagttttacctcggtgatgtcgatgggggtgatgctg
tttcagctctacatggtggtgctggtgctgtggctggcgaaaatctttgaacatgatttg
cttgccctgcaacaacgctggttgccgaagctggggatcgtgcaaaaggttctgagcctg
ctgacgcccgttcatcgcggactggaaacattgatgctggtgctggcggtgttgttgggg
gcttataccggctttctgctgtcggcgctgaaatcgtatccgttcctcaataacccgatc
ctgccggtgctgttcctcttctccggcatctcgtccggtgcggcggtggcgctgatcgcc
atggcgatacgccaacgcagtaacccgcattccacggaagcgcagtttgtacaccgtatg
gaaatccctgtggtatggggtgaaatcttcctgctggtggcgttttttgtcggtctggcg
ctgggcgatgacggtaaagttcgtgcgctggtggcggcattaggtggcggtttctggacg
tggtggttctggcttggtgtcgccgggctggggctgattgtgccaatgctgctcaaaccg
tgggtcaatcgcagttccggcattcctgccgtgctggcggcgtgtggggccagtctggtc
ggcgtgttgatgctgcgctttttcattctctacgccggacagttgacggtggcgtaa

DBGET integrated database retrieval system