KEGG   Escherichia coli K-12 MG1655: b4080Help
Entry
b4080             CDS       T00007                                 

Gene name
mdtP
Definition
(RefSeq) outer membrane factor of efflux pump
  KO
K15550  
outer membrane protein, multidrug efflux system
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b4080 (mdtP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4299564..4301030)
Genome map
AA seq 488 aa AA seqDB search
MINRQLSRLLLCSILGSTTLISGCALVRKDSAPHQQLKPEQIKLADDIHLASSGWPQAQW
WKQLNDPQLDALIQRTLSGSHTLAEAKLREEKAQSQADLLDAGSQLQVAALGMLNRQRVS
ANGFLSPYSMDAPALGMDGPYYTEATVGLFAGLDLDLWGVHRSAVAAAIGAHNAALAETA
AVELSLATGVAQLYYSMQASYQMLDLLEQTHDVIDYAVKAHQSKVAHGLEAQVPFHGARA
QILAVDKQIVAVKGQITETRESLRALIGAGASDMPEIRPVALPQVQTGIPATLSYELLAR
RPDLQAMRWYVQASLDQVDSARALFYPSFDIKAFFGLDSIHLHTLFKKTSRQFNFIPGLK
LPLFDGGRLNANLEGTRAASNMMIERYNQSVLNAVRDVAVNGTRLQTLNDEREMQAERVE
ATRFTQRAAEAAYQRGLTSRLQATEARLPVLAEEMSLLMLDSRRVIQSIQLMKSLGGGYQ
AGPVVEKK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcgtcaactttcacgtctgctgttgtgcagcattctcggcagcacgacgctg
atttccggctgtgccctggtacgtaaggattctgcacctcatcaacagctcaaaccggaa
caaatcaaactggccgacgatattcatcttgccagctccggctggccgcaggcgcagtgg
tggaaacaactcaatgacccgcagctggatgcgctgatccaacggacgctaagtggttca
cacaccctcgccgaagcgaaactgcgggaagaaaaagcgcagtcccaggccgatttgtta
gatgccggttcacaattacaggtcgcagcgttagggatgctcaaccgccaacgtgtctcg
gcgaacggctttttaagcccttattcaatggatgcgccagcactgggtatggacgggccg
tactatacggaagccacagtaggtttgtttgccggactggatcttgatttgtggggtgtg
catcgctcagcggttgccgccgccattggcgcgcataatgccgcgctggcagaaaccgca
gcagtagagctatcgctggccacgggcgtagcgcagctttattacagtatgcaggccagc
tatcagatgctcgatctgttagaacaaactcacgatgtgattgattacgcggtgaaagcg
caccagagtaaagtggcgcacggtctggaagcgcaagtgcctttccacggcgcgcgggca
cagattctggcggtcgataaacaaattgttgccgtcaaagggcaaatcaccgaaacgcga
gaatctctgcgtgcattgattggcgcgggagccagcgatatgccggagatcagaccggtg
gcattaccgcaagtccagaccggcattccggcgacactctcttatgagttgctcgccaga
cgcccggatctgcaagccatgcgctggtatgttcaggcgtcattagatcaggtggattcc
gcgcgggcgttgttctatccgagctttgatatcaaagcgtttttcggtctggactccatc
catctgcataccttattcaaaaaaaccagtcgccagttcaacttcatcccgggtctgaaa
ttgccgctgtttgacggtggacggttgaatgccaatctcgaaggcacgcgcgccgccagc
aacatgatgattgaacgttacaaccagtcagtactgaacgcggtgcgtgacgttgccgtc
aacggcacgcgtctgcaaacgctcaacgacgagcgagaaatgcaggctgaacgcgtggaa
gccacgcgctttacccagcgcgctgccgaggccgcctatcagcgcggcttaaccagccgc
ttacaggccaccgaagcccggttgccagtgcttgccgaagagatgtcattactgatgctg
gacagccgccgggtgatccaaagcattcagttgatgaaatcgctgggcggcgggtatcag
gcaggtcccgtcgtcgagaaaaaataa

DBGET integrated database retrieval system