KEGG   Escherichia coli K-12 MG1655: b4081Help
Entry
b4081             CDS       T00007                                 

Gene name
mdtO
Definition
(RefSeq) membrane translocase (MDR) of MdtNOP efflux pump, PET family
  KO
K15547  
multidrug resistance protein MdtO
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4081 (mdtO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4301027..4303078)
Genome map
AA seq 683 aa AA seqDB search
MSALNSLPLPVVRLLAFFHEELSERRPGRVPQTVQLWVGCLLVILISMTFEIPFVALSLA
VLFYGIQSNAFYTKFVAILFVVATVLEIGSLFLIYKWSYGEPLIRLIIAGPILMGCMFLM
RTHRLGLVFFAVAIVAIYGQTFPAMLDYPEVVVRLTLWCIVVGLYPTLLMTLIGVLWFPS
RAISQMHQALNDRLDDAISHLTDSLAPLPETRIEREALALQKLNVFCLADDANWRTQNAW
WQSCVATVTYIYSTLNRYDPTSFADSQAIIEFRQKLASEINKLQHAVAEGQCWQSDWRIS
ESEAMAARECNLENICQTLLQLGQMDPNTPPTPAAKPPSMAADAFTNPDYMRYAVKTLLA
CLICYTFYSGVDWEGIHTCMLTCVIVANPNVGSSYQKMVLRFGGAFCGAILALLFTLLVM
PWLDNIVELLFVLAPIFLLGAWIATSSERSSYIGTQMVVTFALATLENVFGPVYDLVEIR
DRALGIIIGTVVSAVIYTFVWPESEARTLPQKLAGTLGMLSKVMRIPRQQEVTALRTYLQ
IRIGLHAAFNACEEMCQRVALERQLDSEERALLIERSQTVIRQGRDLLHAWDATWNSAQA
LDNALQPDRAGQFADALEKYAAGLATALSRSPQITLEETPASQAILPTLLKQEQHVCQLF
ARLPDWTAPALTPATEQAQGATQ
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgctcaactccctgccattaccggtggtcaggctgctggcgttctttcatgaa
gagttaagcgagcggcgaccaggtcgcgtgccgcagaccgtgcaactctgggtaggctgc
ctgctggtgattctgatctcgatgacctttgagatcccttttgtggcgttatcgctggca
gtgctgttttacggtattcagtcgaacgcgttttacaccaaatttgtcgcgatcttgttt
gtggttgccacggtgctggagatcggcagcctgtttttgatctacaaatggtcatacggc
gaaccgttgatccgattgatcatcgccggaccgatcctgatgggctgcatgtttttgatg
cgcacccatcgcttggggctggtctttttcgccgtcgccattgtcgctatttacgggcaa
accttccccgccatgctcgactatccggaagtggtcgtgcgcttaacgctgtggtgtatc
gttgttggcctctatccaaccttgctgatgacgttaatcggcgtgctgtggtttcccagt
cgtgccatttcgcaaatgcatcaggcgcttaatgatcggcttgatgatgccattagtcac
ctgacagacagcctcgcaccgctacccgaaacgcggattgaaagagaggcgctggcgcta
caaaaactcaatgtcttttgcctcgcggacgatgccaactggcgaactcaaaacgcatgg
tggcaaagctgcgtggcaacggtaacctacatttactcgacgctgaatcgctacgatccc
acctcttttgctgattctcaggcaattattgaattccgacaaaaattagcttcagaaatc
aacaagctgcagcatgccgttgctgaaggtcagtgctggcaaagcgactggcggatcagt
gaaagtgaagcgatggcggcacgggaatgtaacctggagaatatctgccagacgttgtta
caactgggtcagatggacccgaatacgccgccaacgcccgcagccaaaccgccatcaatg
gccgccgatgcttttaccaatccagactatatgcgctacgcggtaaaaacgctgctcgcc
tgtttgatctgttacaccttttacagcggcgtggactgggaaggcattcacacctgtatg
ctgacatgcgtgatcgtcgctaacccaaatgtcggttcgtcgtaccagaagatggtgctg
cgttttggcggggccttttgcggcgcgattctggcgctgttattcacgctactggtcatg
ccctggctggacaatattgtcgaattgctgtttgtgctggcaccgattttcctgttgggc
gcatggattgccaccagctctgaacgctcttcttatatcggcacacagatggtggtcacc
ttcgcgctcgccacgctcgaaaacgtttttggcccagtgtacgacctggtggaaattcgc
gatcgcgccctgggtatcatcattggtaccgtggtgtccgcggtgatttacacctttgtc
tggcctgaaagtgaagcgcgcacactgccgcaaaaactggctggcacgctgggtatgtta
agtaaagtaatgcggatcccacgccagcaggaagtcacggctctgcgcacttatctgcaa
attcgtatcggtctgcatgcggcgtttaatgcctgtgaagagatgtgccaacgcgtggcg
ctggagcgtcaactggacagcgaagaacgcgcattactgattgaacgttcgcaaacggtt
attcgtcagggccgcgatcttcttcacgcctgggatgccacctggaactcggcgcaggcg
ctggataacgcactacagccggacagagcaggtcagtttgccgacgccctggagaaatac
gctgccggtctggcaaccgcactcagccgttctcctcaaataacgcttgaagagacaccc
gcctctcaggccatcctgcccaccttattaaaacaggagcaacacgtctgccagcttttc
gcccgcttgccagactggacagccccggcattaacgcccgccacggaacaggcacaagga
gccacgcaatga

DBGET integrated database retrieval system