KEGG   Escherichia coli K-12 MG1655: b4087Help
Entry
b4087             CDS       T00007                                 

Gene name
alsA
Definition
(RefSeq) fused D-allose transporter subunits of ABC superfamily: ATP-binding components
  KO
K10551  
D-allose transport system ATP-binding protein [EC:3.6.3.17]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
D-Allose transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b4087 (alsA)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     b4087 (alsA)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Allose transporter [MD:M00217] [OT]
    b4087 (alsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4309448..4310980)
Genome map
AA seq 510 aa AA seqDB search
MATPYISMAGIGKSFGPVHALKSVNLTVYPGEIHALLGENGAGKSTLMKVLSGIHEPTKG
TITINNISYNKLDHKLAAQLGIGIIYQELSVIDELTVLENLYIGRHLTKKICGVNIIDWR
EMRVRAAMMLLRVGLKVDLDEKVANLSISHKQMLEIAKTLMLDAKVIIMDEPTSSLTNKE
VDYLFLIMNQLRKEGTAIVYISHKLAEIRRICDRYTVMKDGSSVCSGIVSDVSNDDIVRL
MVGRELQNRFNAMKENVSNLAHETVFEVRNVTSRDRKKVRDISFSVCRGEILGFAGLVGS
GRTELMNCLFGVDKRAGGEIRLNGKDISPRSPLDAVKKGMAYITESRRDNGFFPNFSIAQ
NMAISRSLKDGGYKGAMGLFHEVDEQRTAENQRELLALKCHSVNQNITELSGGNQQKVLI
SKWLCCCPEVIIFDEPTRGIDVGAKAEIYKVMRQLADDGKVILMVSSELPEIITVCDRIA
VFCEGRLTQILTNRDDMSEEEIMAWALPQE
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggccacgccatatatatcgatggcggggatcggcaagtcctttggtccggttcacgca
ttaaagtcggttaatttaacggtttatcctggtgaaatacatgcattactaggagaaaat
ggcgcgggtaaatccacgctaatgaaagttttatccggaatacatgagccgaccaaaggc
accattaccattaataacattagctataacaagctggatcataaattagcggcacaactc
ggtatcgggattatttatcaggaactcagcgttattgatgaattaaccgtactggaaaat
ttatatattggtcgtcatctgacgaaaaaaatctgtggcgtcaatattatcgactggcga
gaaatgcgtgtccgcgccgccatgatgttattacgcgtgggcttgaaagttgatctagat
gagaaagtggcgaatttatctatcagccacaagcagatgctagaaattgccaaaacgctg
atgctcgatgccaaagtcatcatcatggatgaacccacctcctcactcaccaataaagag
gtggactatctgtttctgatcatgaatcagttgcgtaaagagggtacggccatcgtctat
atctcgcataagttggcggaaattcgccgtatttgcgaccgctatacggtgatgaaagac
ggcagcagcgtttgcagcggcatagtaagcgatgtgtcaaatgacgatatcgtccgtctg
atggtaggccgcgaactgcaaaaccgttttaacgcgatgaaggagaatgtcagcaacctt
gcgcacgaaacggtttttgaggtgcggaacgtcaccagtcgtgacagaaaaaaggtccgg
gatatctcatttagcgtctgccggggagaaatattaggctttgccggactggtcggttcc
ggacgtactgaactgatgaattgtctgtttggcgtggataaacgcgctggcggagaaatc
cgtcttaatggcaaagatatctctccacgttcacccctggatgccgtgaaaaaagggatg
gcttacatcactgaaagccgccgggataacggttttttccccaacttttccatcgctcag
aacatggcgatcagccgcagtctgaaagacggcggctataaaggcgcgatgggcttgttt
catgaagttgacgagcaacgtaccgctgaaaatcaacgcgaactgctggcgctgaaatgt
cattcggtaaaccagaatatcaccgaactctccgggggaaatcagcagaaagtcctgatc
tccaaatggctgtgctgttgcccggaagtgattattttcgatgaacctacccgcggcatc
gacgttggcgcgaaagccgaaatttacaaagtgatgcgccaactggcggacgacggaaaa
gtcatcctgatggtgtcatctgaactacctgaaattatcaccgtctgcgaccgcatcgcc
gtgttctgcgaaggacgactgacgcaaatcctgacgaatcgcgatgacatgagcgaagag
gagattatggcatgggctttaccacaagagtaa

DBGET integrated database retrieval system