KEGG   Escherichia coli K-12 MG1655: b4088Help
Entry
b4088             CDS       T00007                                 

Gene name
alsB
Definition
(RefSeq) D-allose transporter subunit
  KO
K10549  
D-allose transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
D-Allose transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b4088 (alsB)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   D-Allose transporter [MD:M00217] [OT]
    b4088 (alsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4311107..4312042)
Genome map
AA seq 311 aa AA seqDB search
MNKYLKYFSGTLVGLMLSTSAFAAAEYAVVLKTLSNPFWVDMKKGIEDEAKTLGVSVDIF
ASPSEGDFQSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVARAWKKGIYLVNLDEKIDMD
NLKKAGGNVEAFVTTDNVAVGAKGASFIIDKLGAEGGEVAIIEGKAGNASGEARRNGATE
AFKKASQIKLVASQPADWDRIKALDVATNVLQRNPNIKAIYCANDTMAMGVAQAVANAGK
TGKVLVVGTDGIPEARKMVEAGQMTATVAQNPADIGATGLKLMVDAEKSGKVIPLDKAPE
FKLVDSILVTQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatatctgaaatatttcagcggcacactcgtgggcttaatgttgtcaaccagc
gcttttgctgccgccgaatatgctgtcgtattgaaaaccctctccaacccattttgggta
gatatgaaaaaaggcattgaagatgaagcaaaaacactgggcgtcagcgttgatattttt
gcctctccttcagaaggcgattttcaatctcaattgcagttatttgaagatctcagtaat
aaaaattacaaaggtatcgccttcgctccattatcctcagtgaatctggtcatgcctgtc
gcccgcgcatggaaaaaaggcatttatctggttaatctcgatgaaaaaatcgacatggat
aatctgaaaaaagctggcggcaatgtggaagcttttgtcaccaccgataacgttgctgtc
ggggcgaaaggcgcgtcgttcattattgacaaattgggcgctgaaggtggtgaagtcgca
atcattgagggtaaagccggtaacgcctccggtgaagcgcgtcgtaatggtgccaccgaa
gccttcaaaaaagcaagccagatcaagcttgtcgccagccagcctgccgactgggaccgc
attaaagcactggatgtcgccactaacgtgttgcaacgtaatccgaatattaaagcgatc
tattgcgcgaatgacacgatggcaatgggtgttgctcaggcagtcgcaaacgccggaaaa
acgggaaaagtgctggtcgtcggtacagatggcattccggaagcccgcaaaatggtggaa
gccggacaaatgaccgcgacggttgcccagaacccggcggatatcggcgcaacgggtctg
aagctgatggttgacgctgagaaatccggcaaggttatcccgctggataaagcaccggaa
tttaaactggtcgattcaatcctggtcactcaataa

DBGET integrated database retrieval system