KEGG   Escherichia coli K-12 MG1655: b4090Help
Entry
b4090             CDS       T00007                                 

Gene name
rpiB
Definition
ribose 5-phosphate isomerase B/allose 6-phosphate isomerase (EC:5.3.1.6)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:eco01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eco01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:eco00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eco00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4313350..4313799
Genome map
AA seq 149 aa AA seqDB search
MKKIAFGCDHVGFILKHEIVAHLVERGVEVIDKGTWSSERTDYPHYASQVALAVAGGEVD
GGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMI
VDAWLGAQYEGGRHQQRVEAITAIEQRRN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgcatttggctgtgatcatgtcggtttcattttaaaacatgaaatagtg
gcacatttagttgagcgtggcgttgaagtgattgataaaggaacctggtcgtcagagcgt
actgattatccacattacgccagtcaagtcgcactggctgttgctggcggagaggttgat
ggcgggattttgatttgtggtactggcgtcggtatttcgatagcggcgaacaagtttgcc
ggaattcgcgcggtcgtctgtagcgaaccttattccgcgcaactttcgcggcagcataac
gacaccaacgtgctggcttttggttcacgagtggttggcctcgaactggcaaaaatgatt
gtggatgcgtggctgggcgcacagtacgaaggcggtcgtcatcaacaacgcgtggaggcg
attacggcaatagagcagcggagaaattga

DBGET integrated database retrieval system