KEGG   Escherichia coli K-12 MG1655: b4105Help
Entry
b4105             CDS       T00007                                 

Gene name
phnD
Definition
(RefSeq) phosphonate ABC transporter periplasmic binding protein
  KO
K02044  
phosphonate transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b4105 (phnD)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphonate transporter [MD:M00223] [OT]
    b4105 (phnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4323336..4324352)
Genome map
AA seq 338 aa AA seqDB search
MNAKIIASLAFTSMFSLSTLLSPAHAEEQEKALNFGIISTESQQNLKPQWTPFLQDMEKK
LGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYW
SVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVN
AGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLS
ETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQGVKSNKG
LNEQDKLAKTTEIQAQLDDLDRLNNALSAMSSVSKAVQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctaagataattgcctcgctggccttcaccagcatgttcagcctcagcaccctg
ttaagcccggcgcacgccgaagagcaggaaaaggcgttgaatttcggcattatttcaacg
gaatcacagcaaaacctgaaaccgcaatggacgccgttcttgcaggatatggagaagaag
ctgggcgtgaaggtcaacgccttctttgccccggactacgcgggcattatccaggggatg
cgcttcaataaagtggatatcgcctggtacggcaatctgtcggcgatggaagcggtggat
cgcgccaatggccaggtcttcgcccagacggtcgcggcggatggatcgccgggttactgg
agcgtgttgatcgtcaacaaagacagtccgatcaacaacctgaacgatctgctggcgaag
cggaaagatctcacctttggcaatggcgatcctaactccacctctggcttcctcgtcccc
ggctactacgtcttcgccaaaaacaatatctccgccagcgacttcaagcgcaccgtcaac
gccgggcatgaaaccaacgcgctggccgtcgccaacaagcaggtggatgttgccaccaac
aacaccgaaaacctcgacaagctgaaaacctccgcgccagagaagctgaaagaactgaag
gtgatctggaagtcgccgctgatcccaggcgatccgatcgtctggcgcaagaatctttcc
gaaaccaccaaagacaagatctacgacttctttatgaactacggcaaaacgccggaagaa
aaagcggtgctggaacgcctgggctgggcgccattccgcgcttccagcgacctgcaactg
gtgccgattcgccagctcgcgctgtttaaagagatgcagggcgtgaaaagcaataaagga
ctgaatgagcaggacaagctggcaaaaaccaccgagattcaggcgcagctggatgacctg
gaccgcctgaacaacgcgctaagcgcgatgagttcggtgagtaaagcggtgcagtaa

DBGET integrated database retrieval system