KEGG   Escherichia coli K-12 MG1655: b4111Help
Entry
b4111             CDS       T00007                                 

Gene name
proP
Definition
(RefSeq) proline/glycine betaine transporter
  KO
K03762  
MFS transporter, MHS family, proline/betaine transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Metabolite:H+ symporter (MHS) family [TC:2.A.1.6]
    b4111 (proP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4330502..4332004
Genome map
AA seq 500 aa AA seqDB search
MLKRKKVKPITLRDVTIIDDGKLRKAITAASLGNAMEWFDFGVYGFVAYALGKVFFPGAD
PSVQMVAALATFSVPFLIRPLGGLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYD
TIGIWAPILLLICKMAQGFSVGGEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGA
GVVVLISTIVGEANFLDWGWRIPFFIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDRE
GLQDGPKVSFKEIATKYWRSLLTCIGLVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVLI
IIAIMIGMLFVQPVMGLLSDRFGRRPFVLLGSVALFVLAIPAFILINSNVIGLIFAGLLM
LAVILNCFTGVMASTLPAMFPTHIRYSALAAAFNISVLVAGLTPTLAAWLVESSQNLMMP
AYYLMVVAVVGLITGVTMKETANRPLKGATPAASDIQEAKEILVEHYDNIEQKIDDIDHE
IADLQAKRTRLVQQHPRIDE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaaggaaaaaagtaaaaccgattacccttcgtgatgtcaccattattgatgac
ggtaaactgcgtaaagccattaccgcagcatcactgggtaatgcaatggaatggttcgat
tttggtgtttatggttttgttgcttacgcattaggtaaagtttttttcccgggggctgac
cccagcgtgcagatggttgctgcacttgccactttctccgttccctttctgattcgaccg
cttggcggactcttctttggtatgttgggcgataaatatggtcgccagaagatcctcgct
atcactattgtgattatgtcgatcagtacgttctgtattggcttaataccgtcctacgac
acgattggtatttgggcaccgattctgctgttgatctgtaagatggcacaaggtttctcg
gtcggcggtgaatataccggggcgtcgatatttgttgcggaatactcccctgaccgtaaa
cgtggctttatgggcagctggctggacttcggttctattgccgggtttgtgctgggtgcg
ggcgtggtggtgttaatttcgaccattgtcggcgaagcgaacttcctcgattggggctgg
cgtattccgttctttatcgctctgccgttagggattatcgggctttacctgcgccatgcg
ctggaagagactccggcgttccagcagcatgtcgataaactggaacagggcgaccgtgaa
ggtttgcaggatggcccgaaagtctcgtttaaagagattgccactaaatactggcgcagc
ctgttgacatgtattggtctggtaattgccaccaacgtgacttactacatgttgctgacc
tatatgccgagttatttgtcgcataacctgcattactccgaagaccacggggtgctgatt
attatcgccattatgatcggtatgctgtttgtccagccggtgatgggcttgctgagtgac
cgttttggccgtcgtccgtttgtgctacttggtagtgttgccctgtttgtgttggcgatc
ccggcgtttattctgattaacagtaacgtcatcggcctgatttttgccgggttactgatg
ctggcggtgatccttaactgctttacgggcgttatggcttctaccttgccagcgatgttc
ccgacgcatatccgttacagcgcgctggcggcggcatttaatatttcggtgctggttgcc
ggtctgacgccaacgctggcggcctggctggtcgaaagctcgcagaatctgatgatgcct
gcctattacctgatggtagtggcggtggttggtttaatcaccggcgtaaccatgaaagag
acggcaaatcgtccgttgaaaggtgcgacaccggcggcgtcagatatacaggaagcgaag
gaaattctcgtcgagcattacgataatatcgagcagaaaatcgatgatattgaccacgag
attgccgatttgcaggcgaaacgtacccgcctggtgcagcaacatccgcgaattgatgaa
taa

DBGET integrated database retrieval system