KEGG   Escherichia coli K-12 MG1655: b4123Help
Entry
b4123             CDS       T00007                                 

Gene name
dcuB
Definition
(RefSeq) C4-dicarboxylate transporter, anaerobic; DcuS co-sensor
  KO
K07792  
anaerobic C4-dicarboxylate transporter DcuB
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b4123 (dcuB)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4123 (dcuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4347404..4348744)
Genome map
AA seq 446 aa AA seqDB search
MLFTIQLIIILICLFYGARKGGIALGLLGGIGLVILVFVFHLQPGKPPVDVMLVIIAVVA
ASATLQASGGLDVMLQIAEKLLRRNPKYVSIVAPFVTCTLTILCGTGHVVYTILPIIYDV
AIKNNIRPERPMAASSIGAQMGIIASPVSVAVVSLVAMLGNVTFDGRHLEFLDLLAITIP
STLIGILAIGIFSWFRGKDLDKDEEFQKFISVPENREYVYGDTATLLDKKLPKSNWLAMW
IFLGAIAVVALLGADSDLRPSFGGKPLSMVLVIQMFMLLTGALIIILTKTNPASISKNEV
FRSGMIAIVAVYGIAWMAETMFGAHMSEIQGVLGEMVKEYPWAYAIVLLLVSKFVNSQAA
ALAAIVPVALAIGVDPAYIVASAPACYGYYILPTYPSDLAAIQFDRSGTTHIGRFVINHS
FILPGLIGVSVSCVFGWIFAAMYGFL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttatttactatccaacttatcataatactgatatgtctgttttatggtgccagaaag
ggtggtatcgcgctgggtttattaggcggtatcggtctggtcattctggtcttcgtcttc
caccttcagccaggtaaaccaccagttgatgtcatgctggttatcattgcggtggtggcg
gcatcggcgaccttgcaagcttcgggcggtcttgatgtcatgctgcaaattgccgagaag
ctgctgcgccgcaacccgaaatatgtctcaattgtcgcgccgtttgtgacctgtacactg
accattctttgcggtacgggtcatgtggtttacaccattctgccgatcatctacgacgtc
gccattaagaacaacatccgtccggaacgtccgatggcggcaagttctatcggtgcacag
atggggattatcgccagtccggtgtcggttgcggtcgtgtctctggttgcgatgctgggt
aatgtcacctttgatggtcgccatcttgagttcctcgatctgctggcaatcaccattcca
tcgacgttaatcggtatcctggcgatcggtatcttcagctggttccgcggtaaagatctg
gataaagacgaagagttccagaaattcatctccgtaccggaaaaccgtgagtatgtttac
ggtgataccgcgacgctgctggataaaaaactgccgaaaagcaactggctggcaatgtgg
attttcctcggggcaatcgctgtagtcgcccttcttggtgctgattcggacctgcgtcca
tccttcggcggcaaaccgctgtcgatggtactggttattcagatgtttatgctgctgacc
ggggcgctgattattatcctgaccaaaaccaatcccgcgtctatctcaaaaaacgaagtc
ttccgttccggtatgatcgccatcgtggcggtgtacggtatcgcatggatggcagaaacc
atgttcggtgcgcatatgtctgaaattcagggcgtactgggtgaaatggtgaaagagtat
ccgtgggcctatgccattgttctgctgctggtttccaagtttgtaaactctcaggctgcg
gcgctggcggcgattgttccggtcgcgctggcgatcggcgttgatccggcatacatcgtg
gcttcagcaccggcttgctacggttattacatcctgccgacttatccgagcgatctggca
gcgattcagtttgaccgttccggcaccacccacatcggtcgcttcgtcatcaaccacagc
tttattctgccggggttgattggtgtgagcgtatcgtgcgtcttcggctggatcttcgcc
gcgatgtacgggttcttataa

DBGET integrated database retrieval system