KEGG   Escherichia coli K-12 MG1655: b4130Help
Entry
b4130             CDS       T00007                                 

Gene name
dtpC
Definition
(RefSeq) dipeptide and tripeptide permease
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-GeneID: 948644
NCBI-ProteinID: NP_418554
Pasteur: yjdL
RegulonDB: ECK120002307
ECOCYC: EG12469
ASAP: ABE-0013524
UniProt: P39276
Position
complement(4354954..4356411)
Genome map
AA seq 485 aa AA seqDB search
MKTPSQPRAIYYIVAIQIWEYFSFYGMRALLILYLTHQLGFDDNHAISLFSAYASLVYVT
PILGGWLADRLLGNRTAVIAGALLMTLGHVVLGIDTNSTFSLYLALAIIICGYGLFKSNI
SCLLGELYDENDHRRDGGFSLLYAAGNIGSIAAPIACGLAAQWYGWHVGFALAGGGMFIG
LLIFLSGHRHFQSTRSMDKKALTSVKFALPVWSWLVVMLCLAPVFFTLLLENDWSGYLLA
IVCLIAAQIIARMMIKFPEHRRALWQIVLLMFVGTLFWVLAQQGGSTISLFIDRFVNRQA
FNIEVPTALFQSVNAIAVMLAGVVLAWLASPESRGNSTLRVWLKFAFGLLLMACGFMLLA
FDARHAAADGQASMGVMISGLALMGFAELFIDPVAIAQITRLKMSGVLTGIYMLATGAVA
NWLAGVVAQQTTESQISGMAIAAYQRFFSQMGEWTLACVAIIVVLAFATRFLFSTPTNMI
QESND
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaccctcacagccgcgcgcgatatactatatcgtggcgatccaaatctgggag
tacttcagtttttacggcatgcgtgccttactcattctctatctcacccatcagcttggt
tttgatgataaccatgccatcagcctgttcagcgcatatgcttctctggtttacgttacc
cctattctcggcggctggcttgccgaccgcctgctcggcaaccgcactgcagtgattgcc
ggcgcgctgttaatgacccttggccatgtggtgctgggtattgatacaaattcaaccttt
agcctgtatctggcgctggcaatcattatttgtggctacggtttattcaaatcaaacatc
agctgtttgcttggcgagctctacgacgagaacgatcatcgacgtgatggcggtttttcg
ctgctgtatgctgcgggcaatatcggttctatcgcagccccaatcgcctgcggcctggct
gctcagtggtatggatggcatgttggctttgcccttgcgggtggcggcatgtttatcggt
ttgttgattttcttaagcggtcatcgtcatttccagtccacacgtagtatggataaaaaa
gcgctcactagtgtcaaatttgccttaccagtatggagctggttagtggtgatgctctgt
ttagccccagtattttttactctgctgctggagaacgactggtccggatatttgctggcg
atcgtttgcctcattgccgcacaaatcattgcccgcatgatgatcaaattccccgaacat
cgccgtgctctttggcaaattgtattgttgatgtttgtcgggacattgttctgggtactg
gcacaacagggcggcagtaccatcagcttgtttatcgatcgctttgtgaatcgtcaggca
ttcaatattgaagtacctacagcactattccagtcggtgaatgcaattgcggtgatgctc
gctggggttgtactggcctggctggcgtcgccagaaagccgcggcaactcaacattgcgc
gtctggctgaagtttgcctttggcttactgctgatggcttgtggctttatgttgttggca
tttgatgcccgacatgcagcggctgacggtcaagcgtcaatgggcgtgatgatatccggg
ctggcgctaatgggctttgccgaactctttattgacccggtggcgattgcgcaaatcacg
cgtctgaaaatgtctggcgtattaaccgggatttatatgctggcaacaggcgcggtcgcc
aactggctggcaggcgtcgtggcacagcagacgacagagtcgcaaattagcggtatggca
attgcagcttaccagcgattcttttctcagatgggagagtggacgttggcttgtgtcgcg
atcatcgtcgtattggcctttgctacccgttttctgtttagcacgccgacgaatatgata
caggagagcaacgattaa

DBGET integrated database retrieval system