KEGG   Escherichia coli K-12 MG1655: b4132Help
Entry
b4132             CDS       T00007                                 

Gene name
cadB
Definition
(RefSeq) putative lysine/cadaverine transporter
  KO
K03757  
cadaverine:lysine antiporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4132 (cadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4358697..4360031)
Genome map
AA seq 444 aa AA seqDB search
MSSAKKIGLFACTGVVAGNMMGSGIALLPANLASIGGIAIWGWIISIIGAMSLAYVYARL
ATKNPQQGGPIAYAGEISPAFGFQTGVLYYHANWIGNLAIGITAVSYLSTFFPVLNDPVP
AGIACIAIVWVFTFVNMLGGTWVSRLTTIGLVLVLIPVVMTAIVGWHWFDAATYAANWNT
ADTTDGHAIIKSILLCLWAFVGVESAAVSTGMVKNPKRTVPLATMLGTGLAGIVYIAATQ
VLSGMYPSSVMAASGAPFAISASTILGNWAAPLVSAFTAFACLTSLGSWMMLVGQAGVRA
ANDGNFPKVYGEVDSNGIPKKGLLLAAVKMTALMILITLMNSAGGKASDLFGELTGIAVL
LTMLPYFYSCVDLIRFEGVNIRNFVSLICSVLGCVFCFIALMGASSFELAGTFIVSLIIL
MFYARKMHERQSHSMDNHTASNAH
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagttctgccaagaagatcgggctatttgcctgtaccggtgttgttgccggtaatatg
atggggagcggtattgcattattacctgcgaacctagcaagtatcggtggtattgctatc
tggggttggattatctctattattggtgcaatgtcgctggcgtatgtatatgcccgactg
gcaacaaaaaacccgcaacaaggtggcccaattgcttatgccggagaaatttcccctgca
tttggttttcagacaggtgttctttattaccatgctaactggattggtaacctggcgatt
ggtattaccgctgtatcttatctttccaccttcttcccagtattaaatgatcctgttccg
gcgggtatcgcctgtattgctatcgtctgggtatttacctttgtaaatatgctcggcggt
acttgggtaagccgtttaaccactattggtctggtgctggttcttattcctgtggtgatg
actgctattgttggctggcattggtttgatgcggcaacttatgcagctaactggaatact
gcggataccactgatggtcatgcgatcattaaaagtattctgctctgcctgtgggccttc
gtgggtgttgaatccgcagctgtaagtactggtatggttaaaaacccgaaacgtaccgtt
ccgctggcaaccatgctgggtactggtttagcaggtattgtttacatcgctgcgactcag
gtgctttccggtatgtatccgtcttctgtaatggcggcttccggtgctccgtttgcaatc
agtgcttcaactatcctcggtaactgggctgcgccgctggtttctgcattcaccgccttt
gcgtgcctgacttctctgggctcctggatgatgttggtaggccaggcaggtgtacgtgcc
gctaacgacggtaacttcccgaaagtttatggtgaagtcgacagcaacggtattccgaaa
aaaggtctgctgctggctgcagtgaaaatgactgccctgatgatccttatcactctgatg
aactctgccggtggtaaagcatctgacctgttcggtgaactgaccggtatcgcagtactg
ctgactatgctgccgtatttctactcttgcgttgacctgattcgttttgaaggcgttaac
atccgcaactttgtcagcctgatctgctctgtactgggttgcgtgttctgcttcatcgcg
ctgatgggcgcaagctccttcgagctggcaggtaccttcatcgtcagcctgattatcctg
atgttctacgctcgcaaaatgcacgagcgccagagccactcaatggataaccacaccgcg
tctaacgcacattaa

DBGET integrated database retrieval system