KEGG   Escherichia coli K-12 MG1655: b4136Help
Entry
b4136             CDS       T00007                                 

Gene name
dsbD
Definition
(RefSeq) fused thiol:disulfide interchange protein: activator of DsbC/conserved protein (EC:1.8.1.8)
  KO
K04084  
thiol:disulfide interchange protein DsbD [EC:1.8.1.8]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.8  protein-disulfide reductase
     b4136 (dsbD)
Chaperones and folding catalysts [BR:eco03110]
 Protein folding catalysts
  Protein disulfide isomerase
   b4136 (dsbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4363345..4365042)
Genome map
AA seq 565 aa AA seqDB search
MAQRIFTLILLLCSTSVFAGLFDAPGRSQFVPADQAFAFDFQQNQHDLNLTWQIKDGYYL
YRKQIRITPEHAKIADVQLPQGVWHEDEFYGKSEIYRDRLTLPVTINQASAGATLTVTYQ
GCADAGFCYPPETKTVPLSEVVANNAAPQPVSVPQQEQPTAQLPFSALWALLIGIGIAFT
PCVLPMYPLISGIVLGGKQRLSTARALLLTFIYVQGMALTYTALGLVVAAAGLQFQAALQ
HPYVLIGLAIVFTLLAMSMFGLFTLQLPSSLQTRLTLMSNRQQGGSPGGVFVMGAIAGLI
CSPCTTAPLSAILLYIAQSGNMWLGGGTLYLYALGMGLPLMLITVFGNRLLPKSGPWMEQ
VKTAFGFVILALPVFLLERVIGDVWGLRLWSALGVAFFGWAFITSLQAKRGWMRIVQIIL
LAAALVSVRPLQDWAFGATHTAQTQTHLNFTQIKTVDELNQALVEAKGKPVMLDLYADWC
VACKEFEKYTFSDPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQ
EHPQARVTGFMDAETFSAHLRDRQP
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacgcatctttacgctgatcctgctactttgcagcacttccgtttttgccgga
ttattcgacgcgccgggacgttcacaatttgtccccgcggatcaagcctttgcttttgat
tttcagcaaaaccaacatgaccttaatctgacctggcagatcaaagacggttactacctc
taccgtaaacagatccgcattacgccggaacacgcgaaaattgccgacgtgcagctgccg
caaggcgtctggcatgaagatgagttttacggcaaaagcgagatttaccgcgatcggctg
acgcttcccgtcaccatcaaccaggcgagtgcgggagcgacgttaactgtcacctaccag
ggctgtgctgatgccggtttctgttatccgccagaaaccaaaaccgttccgttaagcgaa
gtggtcgccaacaacgcagcgccacagcctgtgtctgttccgcagcaagagcagcccacc
gcgcaattgcccttttccgcgctctgggcgttgttgatcggtattggtatcgcctttacg
ccatgcgtgctgccaatgtacccactgatttctggcatcgtgctgggtggtaaacagcgg
ctctccactgccagagcattgttgctgacctttatttatgtgcaggggatggcgctgacc
tacacggcgctgggtctggtggttgccgccgcagggttacagttccaggcggcgctacag
cacccatacgtgctcattggcctcgccatcgtctttaccttgctggcgatgtcaatgttt
ggcttgtttaccctgcaactcccctcttcgctgcaaacacgtctcacgttgatgagcaat
cgccaacagggcggctcacctggcggtgtgtttgttatgggggcgattgccggactgatc
tgttcaccatgcaccaccgcaccgcttagcgcgattctgctgtatatcgcccaaagcggg
aacatgtggctgggcggcggcacgctttatctctatgcgttgggcatgggcctgccgctg
atgctaattaccgtctttggtaaccgcttgctgccgaaaagcggcccgtggatggaacaa
gtcaaaaccgcgtttggttttgtgatcctcgcactgccggtcttcctgctggagcgagtg
attggtgatgtatggggattacgcttgtggtcggcgctgggtgtcgcattctttggctgg
gcctttatcaccagcctacaggctaaacgcggctggatgcgtattgtgcaaattattctg
ctggcagcggcattggttagcgtgcgcccacttcaggattgggcatttggtgcgacgcat
accgcgcaaactcagacgcatctcaactttacacaaatcaaaacggtagatgagttaaat
caggcgctcgttgaagccaaaggcaaaccggtgatgttagatctttatgccgactggtgc
gtcgcctgtaaagagtttgagaaatacaccttcagcgacccgcaggtgcaaaaagcgtta
gcagacacggtcttacttcaggccaacgtcacggccaacgacgcacaagatgtggcgctg
ttaaagcatcttaatgtccttggcctaccgacaattctcttttttgacggacaaggccag
gagcatccacaagcacgcgtcacgggctttatggatgctgaaaccttcagcgcacatttg
cgcgatcgccaaccgtga

DBGET integrated database retrieval system