KEGG   Escherichia coli K-12 MG1655: b4138Help
Entry
b4138             CDS       T00007                                 

Gene name
dcuA
Definition
(RefSeq) C4-dicarboxylate antiporter
  KO
K07791  anaerobic C4-dicarboxylate transporter DcuA
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b4138 (dcuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcuA_DcuB
Motif
Other DBs
NCBI-GeneID: 948659
NCBI-ProteinID: NP_418561
Pasteur: dcuA
RegulonDB: ECK120001203
ECOCYC: EG11225
ASAP: ABE-0013546
UniProt: P0ABN5
Position
complement(4365472..4366773)
Genome map
AA seq 433 aa AA seqDB search
MLVVELIIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVKPGNIPFDVISIIMAVIAAI
SAMQVAGGLDYLVHQTEKLLRRNPKYITILAPIVTYFLTIFAGTGNISLATLPVIAEVAK
EQGVKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGISYLHLLSVVIPSTLLAVL
VMSFLVTMLFNSKLSDDPIYRKRLEEGLVELRGEKQIEIKSGAKTSVWLFLLGVVGVVIY
AIINSPSMGLVEKPLMNTTNAILIIMLSVATLTTVICKVDTDNILNSSTFKAGMSACICI
LGVAWLGDTFVSNNIDWIKDTAGEVIQGHPWLLAVIFFFASALLYSQAATAKALMPMALA
LNVSPLTAVASFAAVSGLFILPTYPTLVAAVQMDDTGTTRIGKFVFNHPFFIPGTLGVAL
AVCFGFVLGSFML
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgctagttgtagaactcatcatagttttgctggcgatcttcttgggcgccagattgggg
ggaataggtattggttttgcaggcggattgggggtgctggttcttgccgctattggcgtt
aaacccggtaacatcccgttcgatgtcatctccattatcatggcggttatcgccgctatt
tctgccatgcaggttgctggcggtctggactatctggttcatcagacagaaaagctgctg
cgccgtaacccgaaatacatcacgatcctcgcaccgatcgtgacctatttcctgactatc
tttgctggtactggcaacatctctctggcgacactgccagttatcgctgaagttgcgaag
gaacaaggcgttaaaccttgccgtccgctgtctactgcagtggtatccgcgcagattgcg
atcaccgcatcgccaatctcagcggcagtggtttacatgtcttccgtgatggaaggtcat
ggcatcagctacctccatctgctctccgtggtcatcccgtccaccctgctggcggttctg
gtgatgtccttcctggtcactatgctgttcaactccaaactctctgacgatccgatttat
cgcaagcgtctggaagagggcctggttgaactgcgcggtgaaaagcagattgaaatcaaa
tccggtgcaaaaacgtccgtctggctgttcctgctgggcgtagttggcgtggttatctat
gcaatcatcaacagcccaagcatgggtctggttgaaaaaccgctgatgaacaccaccaac
gcaatcctgatcatcatgctcagcgttgcaactctgaccaccgttatctgtaaagtcgat
accgacaacatcctcaactccagcaccttcaaagcaggtatgagcgcctgtatttgtatc
ctgggtgttgcgtggctgggcgatactttcgtttccaacaacatcgactggatcaaagat
accgctggtgaagtgattcagggtcatccgtggctgctggccgtcatcttcttctttgct
tctgctctgctgtactctcaggctgcaaccgcaaaagcactgatgccgatggctctggca
ctgaacgtttcaccgctgaccgctgttgcttctttcgctgcggtgtctggtctgttcatt
ctgccgacctacccgacgctggttgctgcggtacagatggatgacacgggtactacccgt
atcggtaaattcgtcttcaaccatccgttcttcatcccgggtactctgggtgttgccctg
gccgtttgcttcggcttcgtgctgggtagcttcatgctgtaa

DBGET integrated database retrieval system